Os01t0847200-02

Locus

Os01g0847200

Description

Similar to Mannose-1-phosphate guanyltransferase (EC 2.7.7.13) (ATP-mannose-1- phosphate guanylyltransferase) (GDP-mannose pyrophosphorylase) (NDP- hexose pyrophosphorylase).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsMPG1, MPG1, OsVTC1-1, VTC1-1

Oryzabase Gene Name Synonym(s)

mannose-1-phosphate guanyl transferase 1

Transcript Evidence

AK061976 (DDBJ, Best hit)

AK064779 (DDBJ, Best hit)

Protein Evidence

Q09PG3 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: biosynthetic process (GO:0009058)

Molecular Function: transferase activity (GO:0016740)

Molecular Function: nucleotidyltransferase activity (GO:0016779)

Functional domain (InterPro)

Bacterial transferase hexapeptide repeat (IPR001451)

Nucleotidyl transferase (IPR005835)

Hexapeptide transferase, conserved site (IPR018357)

Full-length cDNA

001-043-A03 (Online Clone Ordering)

J013000B04 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0847200-02)

Others

Oryzabase (11515)

Transcript

1655 bp

>Os01t0847200-02 Similar to Mannose-1-phosphate guanyltransferase (EC 2.7.7.13) (ATP-mannose-1- phosphate guanylyltransferase) (GDP-mannose pyrophosphorylase) (NDP- hexose pyrophosphorylase).
AGCGCAGCACAAAGCCCTCCTCCTTCCACCGCAGCTGCGCTACCTACCTCCAAGAGGGCT
GGTCCGCTGGTCGTGGAGAAGGAAGAGAGATCTTCCAGGCTGATCCCTCCTATTGCTTTC
TCCTTCCCGAGCCCGCTTGAGGATCCCCGCCGGAGTAGGGATTAGGGAGGGGAGAACAGG
AGGCGGCGATTCACCATGAAGGCGCTCATTCTTGTTGGAGGCTTCGGCACTCGCCTTCGG
CCTTTGACGCTCAGTTTCCCAAAGCCTCTTGTTGATTTCGCGAACAAGCCCATGATTCTG
CATCAGATTGAGGCCTTGAAAGAAGTTGGAGTAACAGAAGTTGTTTTAGCCATCAACTAC
CGACCGGAGGTAATGCTCAATTTCCTGAAGGACTTTGAGGATAAGCTTGGCATCACAATC
ACGTGTTCCCAAGAGACTGAGCCCTTGGGAACTGCTGGCCCTCTTGCTCTAGCAAGGGAC
AAGCTTGTGGATGGATCTGGTGAGCCATTCTTTGTCCTCAACAGTGACGTCATAAGTGAA
TACCCTTTTGCTGAGCTCATAAAATTTCACAAGAGCCATGGTGGTGAGGCAACGATTATG
GTCACCAAGGTGGACGAACCATCAAAATATGGTGTTGTGGTTATGGAGGAGGTCACTGGA
ATGGTGGAAAAATTTGTTGAGAAACCAAAAATATTTGTAGGCAACAAGATCAATGCGGGA
ATTTACTTGTTGAATCCATCTGTCCTGGACCGCATCGAGCTGAAGCCAACTTCAATTGAG
AAAGAGGTCTTTCCTCGAATTGCATCTGATGCAAAGCTCTTTGCTCTGGTCCTTCCAGGT
TTTTGGATGGATGTTGGCCAACCAAGGGATTACATTACAGGCTTGCGCCTTTATCTGGAT
TCACTTAGGAAGAGATCAACCAACAGGTTAGCCACTGGAGCACACATTGTTGGGAATGTG
CTAGTTCACGAGAGTGCCAAGATTGGCGAAGGCTGTCTGATTGGTCCTGATGTTGCTATC
GGTCCTGGATGCGTCGTGGAGGATGGTGTGAGGCTTTCCCGTTGCACGGTGATGCGTGGC
GTGCACATTAAGAAGCATGCTTGCATATCAAACAGCATTATTGGATGGCACTCAACTGTT
GGACAATGGGCACGGATAGAAAATATGACTATCCTGGGAGAGGACGTACATGTAGGTGAT
GAGGTCTATACCAACGGCGGTGTTGTTCTCCCGCACAAAGAGATCAAGTCAAGCATCCTG
AAGCCTGAGATTGTCATGTGAACTAACCCTCCTTTTATGTTATGGTATACTCAAGTTCTT
TTAATGCAGTATCTTTAGTTTATACCTGTGATCCTTCCAAGATGTTGACCTAGCATGTGT
GTTACTCACATTCTGAAAACTGCTTCTCAATGAGAATTCAGTGTGCCATATTTGATTGTA
CCTTCATTTGGACCATCCAGTAAAGTTCTCAACCCTGCACCAAGAGGACCAGAAGAAACT
CTTTTTCCTATAAAAGAAGAGGATCAGCCTTGTACTTTGTTCTTTTTGAAACAAATATAT
ACTGCTATATGGAACAGACCCATGATGTATTGCACAATTTGTAGCAAATGATGCAAAGTG
GATAATAATAAGGATCAGGCAGATCCATATAAACT

CDS

1086 bp

>Os01t0847200-02 Similar to Mannose-1-phosphate guanyltransferase (EC 2.7.7.13) (ATP-mannose-1- phosphate guanylyltransferase) (GDP-mannose pyrophosphorylase) (NDP- hexose pyrophosphorylase).
ATGAAGGCGCTCATTCTTGTTGGAGGCTTCGGCACTCGCCTTCGGCCTTTGACGCTCAGT
TTCCCAAAGCCTCTTGTTGATTTCGCGAACAAGCCCATGATTCTGCATCAGATTGAGGCC
TTGAAAGAAGTTGGAGTAACAGAAGTTGTTTTAGCCATCAACTACCGACCGGAGGTAATG
CTCAATTTCCTGAAGGACTTTGAGGATAAGCTTGGCATCACAATCACGTGTTCCCAAGAG
ACTGAGCCCTTGGGAACTGCTGGCCCTCTTGCTCTAGCAAGGGACAAGCTTGTGGATGGA
TCTGGTGAGCCATTCTTTGTCCTCAACAGTGACGTCATAAGTGAATACCCTTTTGCTGAG
CTCATAAAATTTCACAAGAGCCATGGTGGTGAGGCAACGATTATGGTCACCAAGGTGGAC
GAACCATCAAAATATGGTGTTGTGGTTATGGAGGAGGTCACTGGAATGGTGGAAAAATTT
GTTGAGAAACCAAAAATATTTGTAGGCAACAAGATCAATGCGGGAATTTACTTGTTGAAT
CCATCTGTCCTGGACCGCATCGAGCTGAAGCCAACTTCAATTGAGAAAGAGGTCTTTCCT
CGAATTGCATCTGATGCAAAGCTCTTTGCTCTGGTCCTTCCAGGTTTTTGGATGGATGTT
GGCCAACCAAGGGATTACATTACAGGCTTGCGCCTTTATCTGGATTCACTTAGGAAGAGA
TCAACCAACAGGTTAGCCACTGGAGCACACATTGTTGGGAATGTGCTAGTTCACGAGAGT
GCCAAGATTGGCGAAGGCTGTCTGATTGGTCCTGATGTTGCTATCGGTCCTGGATGCGTC
GTGGAGGATGGTGTGAGGCTTTCCCGTTGCACGGTGATGCGTGGCGTGCACATTAAGAAG
CATGCTTGCATATCAAACAGCATTATTGGATGGCACTCAACTGTTGGACAATGGGCACGG
ATAGAAAATATGACTATCCTGGGAGAGGACGTACATGTAGGTGATGAGGTCTATACCAAC
GGCGGTGTTGTTCTCCCGCACAAAGAGATCAAGTCAAGCATCCTGAAGCCTGAGATTGTC
ATGTGA

Protein

362 aa

>Os01t0847200-02 Similar to Mannose-1-phosphate guanyltransferase (EC 2.7.7.13) (ATP-mannose-1- phosphate guanylyltransferase) (GDP-mannose pyrophosphorylase) (NDP- hexose pyrophosphorylase).
MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKEVGVTEVVLAINYRPEVM
LNFLKDFEDKLGITITCSQETEPLGTAGPLALARDKLVDGSGEPFFVLNSDVISEYPFAE
LIKFHKSHGGEATIMVTKVDEPSKYGVVVMEEVTGMVEKFVEKPKIFVGNKINAGIYLLN
PSVLDRIELKPTSIEKEVFPRIASDAKLFALVLPGFWMDVGQPRDYITGLRLYLDSLRKR
STNRLATGAHIVGNVLVHESAKIGEGCLIGPDVAIGPGCVVEDGVRLSRCTVMRGVHIKK
HACISNSIIGWHSTVGQWARIENMTILGEDVHVGDEVYTNGGVVLPHKEIKSSILKPEIV
M*

5'UTR

chr01:36395599..36395713 (+ strand) : 115 bp

chr01:36395840..36395919 (+ strand) : 80 bp

CDS

chr01:36395920..36396030 (+ strand) : 111 bp

chr01:36396518..36396580 (+ strand) : 63 bp

chr01:36396671..36396910 (+ strand) : 240 bp

chr01:36396986..36397657 (+ strand) : 672 bp

3'UTR

chr01:36397658..36398031 (+ strand) : 374 bp

FASTA

>Os01t0847200-02 class=Sequence position=chr01:36395599..36398031 (+ strand)
AGCGCAGCAC AAAGCCCTCC TCCTTCCACC GCAGCTGCGC TACCTACCTC CAAGAGGGCT GGTCCGCTGG TCGTGGAGAA
GGAAGAGAGA TCTTCCAGGC TGATCCCTCC TATTGGTACG GAAGCCCTAA ACTCATCGGA GCTTTGCCGC GGCCGCGAGC
GATCAAATCG AAATCTTTCT TTCTTTGTTC TTTGATGCTC CAACCTAGTG TCGGATTTGA TTTTGACTGT TGCAATGGCA
GCTTTCTCCT TCCCGAGCCC GCTTGAGGAT CCCCGCCGGA GTAGGGATTA GGGAGGGGAG AACAGGAGGC GGCGATTCAC
CATGAAGGCG CTCATTCTTG TTGGAGGCTT CGGCACTCGC CTTCGGCCTT TGACGCTCAG TTTCCCAAAG CCTCTTGTTG
ATTTCGCGAA CAAGCCCATG ATTCTGCATC AGGTAATAAG TGGTTTCGCT AGTACTCTGA TGGAGTAATA AGAGTACTTA
TTTGCAGTGC CAATGGATGA ATTGGGCACA AGTTAATTAT AGTACAGTAT TCTTTACCAA CAGTCCAACA ATGGCACTGG
CCTCTCCATG AAAGGAGGGA GAGGGTGCTA AACTGGTCAG AGAACATTAA TACTATTTGA TTTGTTTATT ACTCCCACAT
AAACATGGTG TAACAACTAA AAATCCATGG TAGGTTGCAC TTGGATGTGA TTGAATGCAC CTTTTTACTA TTCAATTGTT
TCTTTCCTTA GTTATCAATT TGGTTACATG ATTTTGGAAA ACTCTTTTGG TATCACACCA AATTTTCTCT GTCCTCGAAA
ATTCCAATCG GTTATCAAGA GTACTTGATT TATATCCAAA ATGTTGGCTC CAGCAAACAT GAGCATGAGG ATTGAGGAGA
GTAATGAGCT CTGAATTAAA AGTTTTCCGA TTTATGCAGA TTGAGGCCTT GAAAGAAGTT GGAGTAACAG AAGTTGTTTT
AGCCATCAAC TACCGACCGG AGGTAAAAAG GAGATAATCT TTTACTGTTG TCTCATGGTA TAAGTATAAC TAACTTCACA
TTCTAATTGG TTTGCTCTGA TCCGTCTTTT AGGTAATGCT CAATTTCCTG AAGGACTTTG AGGATAAGCT TGGCATCACA
ATCACGTGTT CCCAAGAGAC TGAGCCCTTG GGAACTGCTG GCCCTCTTGC TCTAGCAAGG GACAAGCTTG TGGATGGATC
TGGTGAGCCA TTCTTTGTCC TCAACAGTGA CGTCATAAGT GAATACCCTT TTGCTGAGCT CATAAAATTT CACAAGAGCC
ATGGTGGTGA GGCAACGATT ATGGTCACCA AGGTAGATCC TTTCTTTGAC CACTCTCTTG AATTGTAAAC TTGTGTACTG
TGTATACTGA CTATTATTTC AATATAGGTG GACGAACCAT CAAAATATGG TGTTGTGGTT ATGGAGGAGG TCACTGGAAT
GGTGGAAAAA TTTGTTGAGA AACCAAAAAT ATTTGTAGGC AACAAGATCA ATGCGGGAAT TTACTTGTTG AATCCATCTG
TCCTGGACCG CATCGAGCTG AAGCCAACTT CAATTGAGAA AGAGGTCTTT CCTCGAATTG CATCTGATGC AAAGCTCTTT
GCTCTGGTCC TTCCAGGTTT TTGGATGGAT GTTGGCCAAC CAAGGGATTA CATTACAGGC TTGCGCCTTT ATCTGGATTC
ACTTAGGAAG AGATCAACCA ACAGGTTAGC CACTGGAGCA CACATTGTTG GGAATGTGCT AGTTCACGAG AGTGCCAAGA
TTGGCGAAGG CTGTCTGATT GGTCCTGATG TTGCTATCGG TCCTGGATGC GTCGTGGAGG ATGGTGTGAG GCTTTCCCGT
TGCACGGTGA TGCGTGGCGT GCACATTAAG AAGCATGCTT GCATATCAAA CAGCATTATT GGATGGCACT CAACTGTTGG
ACAATGGGCA CGGATAGAAA ATATGACTAT CCTGGGAGAG GACGTACATG TAGGTGATGA GGTCTATACC AACGGCGGTG
TTGTTCTCCC GCACAAAGAG ATCAAGTCAA GCATCCTGAA GCCTGAGATT GTCATGTGAA CTAACCCTCC TTTTATGTTA
TGGTATACTC AAGTTCTTTT AATGCAGTAT CTTTAGTTTA TACCTGTGAT CCTTCCAAGA TGTTGACCTA GCATGTGTGT
TACTCACATT CTGAAAACTG CTTCTCAATG AGAATTCAGT GTGCCATATT TGATTGTACC TTCATTTGGA CCATCCAGTA
AAGTTCTCAA CCCTGCACCA AGAGGACCAG AAGAAACTCT TTTTCCTATA AAAGAAGAGG ATCAGCCTTG TACTTTGTTC
TTTTTGAAAC AAATATATAC TGCTATATGG AACAGACCCA TGATGTATTG CACAATTTGT AGCAAATGAT GCAAAGTGGA
TAATAATAAG GATCAGGCAG ATCCATATAA ACT