Os01t0847600-01

Locus

Os01g0847600

Description

Aldo-keto reductase, Detoxification of abiotic stress-related reactive aldehydes, Oxidative and heat stress tolerance, Herbicide resistance

RAP-DB Gene Symbol Synonym(s)

ARK1, OsAKR1

RAP-DB Gene Name Synonym(s)

ALDO-KETO REDUCTASE 1, Aldo-keto reductase 1

CGSNL Gene Symbol

ARK1

CGSNL Gene Name

ALDO-KETO REDUCTASE 1

Oryzabase Gene Symbol Synonym(s)

OsARK1

Oryzabase Gene Name Synonym(s)

Aldo-Keto reductase 1

Transcript Evidence

AK242899

Protein Evidence

Q941T8

Literature

PMID: 27611904

PMID: 21246257

Note

Manual Curation

May 2, 2017

Gene Ontology (GO)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: oxidoreductase activity (GO:0016491)

Functional domain (InterPro)

Aldo/keto reductase (IPR020471)

NADP-dependent oxidoreductase domain (IPR023210)

Aldo/keto reductase, conserved site (IPR018170)

Full-length cDNA

J090081K17 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0847600-01)

Others

Oryzabase (9026)

KEGG (Os01t0847600-01)

Transcript

1379 bp

>Os01t0847600-01 Aldo-keto reductase, Detoxification of abiotic stress-related reactive aldehydes, Oxidative and heat stress tolerance, Herbicide resistance
TCCCGTAGTCTCGTGGCCGCGCCGGACTGCCGGGACAACCTAGCCGAGCGCTCCCGCTGG
CCGCTGCCTACAGTAAAGCAGCGCGCTGCGCCCGCCTCGCCGCCGCCTCCGCAGGGTCCC
CGTGCCTTCTCGCACCGGCGGCACCGCTCGATCTCTGCGTGACGGCGTGTGAGGCTGTGG
GGTGGTAGTAGGGGCGGGCGGAGATGGCGAAGCATTTCGTGCTCAACACCGGCGCCAAGA
TCCCCTCGGTGGGGCTCGGCACCTGGCAGTCCGACCCGGGCGTCGTCGGCGACGCCGTCT
ACGCCGCTGTCAAGGCGGGGTACCGGCACATCGATTGCGCCAGAATGTACAAAAATGAAA
ATGAGGTGGGGATAGCTCTGAAGAAGCTATTTGAAGAAGGTGTTGTCAAGCGTGAAGATT
TATTTATCACATCTAAGCTATGGTGTGATTGTCATGCCCCAGAGGATGTGCCTGAGTCAC
TAGACAAAACTCTGAGTGACTTACAGCTTGAGTACCTGGATCTTTACCTTATTCATTGGC
CATTCAGAGTCAAGAAGGGCTCAGGCATTAGTAACACTGAAGACTACATACCACCTGACA
TCCCATCTACCTGGGGAGCAATGGAGAAGCTATATGATTCTGGTAAATCTCGTGCCATTG
GTGTAAGTAACTTCTCATCAAAAAAACTGGGTGACCTGCTTGCTGTAGCCTGTGTACCTC
CAGCTGTTGATCAGGTAGAATGCCATCCTGGTTGGCAGCAAACGAAGCTACATAACTTCT
GCCAGTCAACTGGCGTTCATCTTTCTGCATACTCGCCTCTAGGTTCACCTGGTTCAACAT
GGATGAACAGTAACGTCCTTAAGGAATCCGTCATCATCTCAATTGCAGAGAAGCTCGGCA
AAACTCCTGCACAAGTGGCACTGCACTGGAACATTCAGATGGGTCACAGTGTACTCCCAA
AAAGTGTGACCGAAGAAAGGATAAAGCAGAACATAGATGTTTATGACTGGTCTATTCCAG
AGGACTTGCTTGTTAAGTTCTCTGAGATTAAGCAGGTTAGGCTTCTCAGGGGCGACGTCA
TTGTTAATCCCCACAGCGTTTATAAGACCCATGAGGAGCTCTGGGACGGCGAAATTTAGA
TGCAGTCAGCTTACGTTAGTGCCAGTCACTCTCACTGAACATTATTTTTTCACGAATTTA
CGCTTATCTAATGTATGGTGTTTGAGTCTCTTGAGCTCCTATTCAATGTAATGAACCTGC
TTGATCAGCAGCATCATGTTCCCTTAGAATTCGTATTAGCGCTCCTCTGAATAATACTGG
ATCATGTCATTTGTATGCTTCGCCTCTGGCATCATTTATCCCATGCTACTTGTTTGTCT

CDS

936 bp

>Os01t0847600-01 Aldo-keto reductase, Detoxification of abiotic stress-related reactive aldehydes, Oxidative and heat stress tolerance, Herbicide resistance
ATGGCGAAGCATTTCGTGCTCAACACCGGCGCCAAGATCCCCTCGGTGGGGCTCGGCACC
TGGCAGTCCGACCCGGGCGTCGTCGGCGACGCCGTCTACGCCGCTGTCAAGGCGGGGTAC
CGGCACATCGATTGCGCCAGAATGTACAAAAATGAAAATGAGGTGGGGATAGCTCTGAAG
AAGCTATTTGAAGAAGGTGTTGTCAAGCGTGAAGATTTATTTATCACATCTAAGCTATGG
TGTGATTGTCATGCCCCAGAGGATGTGCCTGAGTCACTAGACAAAACTCTGAGTGACTTA
CAGCTTGAGTACCTGGATCTTTACCTTATTCATTGGCCATTCAGAGTCAAGAAGGGCTCA
GGCATTAGTAACACTGAAGACTACATACCACCTGACATCCCATCTACCTGGGGAGCAATG
GAGAAGCTATATGATTCTGGTAAATCTCGTGCCATTGGTGTAAGTAACTTCTCATCAAAA
AAACTGGGTGACCTGCTTGCTGTAGCCTGTGTACCTCCAGCTGTTGATCAGGTAGAATGC
CATCCTGGTTGGCAGCAAACGAAGCTACATAACTTCTGCCAGTCAACTGGCGTTCATCTT
TCTGCATACTCGCCTCTAGGTTCACCTGGTTCAACATGGATGAACAGTAACGTCCTTAAG
GAATCCGTCATCATCTCAATTGCAGAGAAGCTCGGCAAAACTCCTGCACAAGTGGCACTG
CACTGGAACATTCAGATGGGTCACAGTGTACTCCCAAAAAGTGTGACCGAAGAAAGGATA
AAGCAGAACATAGATGTTTATGACTGGTCTATTCCAGAGGACTTGCTTGTTAAGTTCTCT
GAGATTAAGCAGGTTAGGCTTCTCAGGGGCGACGTCATTGTTAATCCCCACAGCGTTTAT
AAGACCCATGAGGAGCTCTGGGACGGCGAAATTTAG

Protein

312 aa

>Os01t0847600-01 Aldo-keto reductase, Detoxification of abiotic stress-related reactive aldehydes, Oxidative and heat stress tolerance, Herbicide resistance
MAKHFVLNTGAKIPSVGLGTWQSDPGVVGDAVYAAVKAGYRHIDCARMYKNENEVGIALK
KLFEEGVVKREDLFITSKLWCDCHAPEDVPESLDKTLSDLQLEYLDLYLIHWPFRVKKGS
GISNTEDYIPPDIPSTWGAMEKLYDSGKSRAIGVSNFSSKKLGDLLAVACVPPAVDQVEC
HPGWQQTKLHNFCQSTGVHLSAYSPLGSPGSTWMNSNVLKESVIISIAEKLGKTPAQVAL
HWNIQMGHSVLPKSVTEERIKQNIDVYDWSIPEDLLVKFSEIKQVRLLRGDVIVNPHSVY
KTHEELWDGEI*

5'UTR

chr01:36403442..36403644 (+ strand) : 203 bp

CDS

chr01:36403645..36403755 (+ strand) : 111 bp

chr01:36403882..36403932 (+ strand) : 51 bp

chr01:36404422..36404498 (+ strand) : 77 bp

chr01:36404617..36404704 (+ strand) : 88 bp

chr01:36405357..36405632 (+ strand) : 276 bp

chr01:36405743..36405991 (+ strand) : 249 bp

chr01:36407056..36407139 (+ strand) : 84 bp

3'UTR

chr01:36407140..36407379 (+ strand) : 240 bp

FASTA

>Os01t0847600-01 class=Sequence position=chr01:36403442..36407379 (+ strand)
TCCCGTAGTC TCGTGGCCGC GCCGGACTGC CGGGACAACC TAGCCGAGCG CTCCCGCTGG CCGCTGCCTA CAGTAAAGCA
GCGCGCTGCG CCCGCCTCGC CGCCGCCTCC GCAGGGTCCC CGTGCCTTCT CGCACCGGCG GCACCGCTCG ATCTCTGCGT
GACGGCGTGT GAGGCTGTGG GGTGGTAGTA GGGGCGGGCG GAGATGGCGA AGCATTTCGT GCTCAACACC GGCGCCAAGA
TCCCCTCGGT GGGGCTCGGC ACCTGGCAGT CCGACCCGGG CGTCGTCGGC GACGCCGTCT ACGCCGCTGT CAAGGTCCCC
CACTCGCGGC GTCTCCTCCT CTCCTCTTCA TCACCTTTTT CGTTTCGTTT TTTTTTCTCT CTCTACTTTG TGATGGATGA
TGATGGCAAA CCGATATAAG GTTGTTTTCG GATTGTGCAG GCGGGGTACC GGCACATCGA TTGCGCCAGA ATGTACAAAA
ATGAAAATGA GGTAACTTGG TTGGTCCAAA ACTTTGAATC ATTCCCGCAT TACTGGGGTA TCACTGCAGA ATTCTGTAGG
CATGGTCCTC CTAGTTCTCG TCTATGTTTT TGTTTGAAAC GATTCGTGTA TCAATTTTGC ATTAACAGCA TTAGTGAAAA
CAGATCAGCG GCACAAAACA GATGATTTCC GTTCTTGATT CAATTGGGCA ACCTACTGTT ATGGAAACTT GTATGATATT
CCTCCATTTT ATATGGACTG ATAGTGAACT ACTCGTTTAG ATAATAAGTT GATGATCTTC CACCTTCTCA AAAAAAGAAA
AAAGAAAAAA AGTTTACATA GTAAAAGACA AATCTGCACT ACTCAGGGCC ATGCGCTGGC AATCAGAACT CAAAACTAGC
ACTTACCTGT CTTTCTTACT ACTATATGCT TTACACTAGA CCCCAATTTT ATCTTGTTTC AAGACGAGTA ATAATTAATA
AACGCATTTT GGGTTTTCAG GTGGGGATAG CTCTGAAGAA GCTATTTGAA GAAGGTGTTG TCAAGCGTGA AGATTTATTT
ATCACATCTA AGCTATGGTA ACCTTTTGCG TGATTGTCCT GTAAATATGT CTTGTCTTTG CAGTTGAATT GGATTACCTA
GTGCCTGCTT GAGCTTTTAC TTAAACTGAT TGGTGCTGAT GGGTATGTTT GTCAGGTGTG ATTGTCATGC CCCAGAGGAT
GTGCCTGAGT CACTAGACAA AACTCTGAGT GACTTACAGC TTGAGTACCT GGATCTTTAC CTTGTATTTA TCTTATTTTC
TTAAGAATTT GGATCAATAC GTGACTTGCT AGATTCTGTA CTTTCCATCG TCAAAGTCTT GCTTTGGAAC CATTGGCATC
AATCTATACA ACTATCTCTA CATGCTGCAG AATAAGCCTC CTGATCAGTC GATGCACATT GATAAACTGT TACATTATCC
AGCAAAATTT CTGCGAGCTT TTATGGATTA GCCCTGAGAC ATCCAATCAT AATCATCATG TGCTAGACTG TAGTCCATTG
CACGAGAACT TCCTTTTATC ATTCATTGGG TCTGTAGGAA GATATTCCTT TAGTCCTGCC ACGCAACCAC AATAAATAAA
TTAATATAGA ATTATGTTGT TCATATCAGT TCACCTTCTT TCCTTGAATT ATGGTGGATT TTTTTTTCAT CCTAAGGTTT
CTTCTGGGAT CATTACATAT ACCTATATGG TTAATGACTT TGATAACCTT GACAATATTA TTCAGACAAA TTTGCAATAG
TAACATAATA TATTGAACTT GAATAAGTCT TTTCTCCACA TAAATGGGAG GATACCTATG GTTAACCTTT GACTTAATAG
GTTCCTTGTT AAAATAGTTT CAGCATGTTG TTACACTAAT AATAAAAAAT TCTGATCACC ATTACGTTTA TGCAGATTCA
TTGGCCATTC AGAGTCAAGA AGGGCTCAGG CATTAGTAAC ACTGAAGACT ACATACCACC TGACATCCCA TCTACCTGGG
GAGCAATGGA GAAGCTATAT GATTCTGGTA AATCTCGTGC CATTGGTGTA AGTAACTTCT CATCAAAAAA ACTGGGTGAC
CTGCTTGCTG TAGCCTGTGT ACCTCCAGCT GTTGATCAGG TAGAATGCCA TCCTGGTTGG CAGCAAACGA AGCTACATAA
CTTCTGCCAG TCAACTGGCG TTCATCTTTC TGTAAGTCTG TGGTACTTAT ATAATTACTC TGAGTCAATG CTCTTGTTAA
TGAGTCCCGT GGTTTTTAAT TTTCTGAATA CTGCTAATCC TTTTCTTCCT CTTCTTTTTA GGCATACTCG CCTCTAGGTT
CACCTGGTTC AACATGGATG AACAGTAACG TCCTTAAGGA ATCCGTCATC ATCTCAATTG CAGAGAAGCT CGGCAAAACT
CCTGCACAAG TGGCACTGCA CTGGAACATT CAGATGGGTC ACAGTGTACT CCCAAAAAGT GTGACCGAAG AAAGGATAAA
GCAGAACATA GATGTTTATG ACTGGTCTAT TCCAGAGGAC TTGCTTGTTA AGTTCTCTGA GATTAAGCAG GTTAGTTCAA
CATCCTTTGA TCACCTATAT TTAATTGTCA ATGTTTTCAA ACATCTCTAC AGACTTTTTC TTAACAACCA GTGTCTGCAT
ATGATTTGGA CAAACTTACA TTGATACCTG CTAACAATTG GTAGAAGGCT ATATAGAGGA AATTAAAGTT GCAAAGGTCA
TCCATAAAAT GTTTCTAACT TCCATATGGC GACCTTTACT TTTGGAAAAT AAATCATTTG CGAATACTCT CAAAGAAATT
TGTTTTCCTT GAAGCATGCT ACATTTGGCG GTAATTAAGT AAATGAAGCG GTATACTGTA TGTAGCTTCt actccctccg
tcccaaaata taagggattt tggacggttg ggacactttc tagtacaatg aatctggaca tgagtgtcca gattcattgt
actagaaagt ggattttgga cggatgggac actttctagc atccagattc attgtactag aaagtgtccc atccgtccaa
aatcccttat attttgggac atagggagta CTTGGTTTGG AACGTCAATA CCAGGATACT CATAGAAACA TTATTTTATC
CCTTATTAGA CCTGTTCAGG GAAGCACGTG CGCAGCAACA AACATCCATT ATATAGGTCA AGAATATAAC ATCACACTTT
GTGGTTGTAT ACACCCCCGT TGGTGTAGAA ACCGGGTTTT ATAAATTCCC ATTATCTAAA ATAATAATAA TATAACAACA
CACAGTATAA TGAAATGGAT ATGTAGGTTC AAGGCTATTG TAATTTGTAA TATCTCAGCA ATGCTATTAT TCACCTTTGA
TCTCTGGTTA TTATGTTGCC TGTCTCATTT CTCATTACAT GTGCTATAAT TATATTCATC TATTGTCACG TGATCTTGTT
TGGTTTTTAT GTCGCAACCA CTGGCCTTAT CAGGACAATT TTGTACATCT TATGCCATGA GCTATTTTAT TTGCCATCAA
GGCATCAATC AAGTATCTCA TTATCTTGAA CCCCTTCTAC TAACTCATAA CAGTGCACCA GTTATTTCTG ATGTTCTTGT
TTTATGATGT TCAGGTTAGG CTTCTCAGGG GCGACGTCAT TGTTAATCCC CACAGCGTTT ATAAGACCCA TGAGGAGCTC
TGGGACGGCG AAATTTAGAT GCAGTCAGCT TACGTTAGTG CCAGTCACTC TCACTGAACA TTATTTTTTC ACGAATTTAC
GCTTATCTAA TGTATGGTGT TTGAGTCTCT TGAGCTCCTA TTCAATGTAA TGAACCTGCT TGATCAGCAG CATCATGTTC
CCTTAGAATT CGTATTAGCG CTCCTCTGAA TAATACTGGA TCATGTCATT TGTATGCTTC GCCTCTGGCA TCATTTATCC
CATGCTACTT GTTTGTCT

Locus: Os01g0847600

Loading...

Locus: Os01g0847600

Loading...