Os01t0848400-01

Locus

Os01g0848400

Description

BEL1-type homeobox family, Paralog of RI, Seed shattering, Initiation and maintenance of the shoot apical meristem during embryogenesis, Construction of inflorescence architecture

RAP-DB Gene Symbol Synonym(s)

RIL1, qSH1, qsh1, qSH-1

RAP-DB Gene Name Synonym(s)

RI-LIKE1, Shattering (QTL)-1, QTL of seed shattering in chromosome 1

CGSNL Gene Symbol

qSH1

CGSNL Gene Name

Shattering (QTL)-1

Oryzabase Gene Symbol Synonym(s)

qSH1, qsh1, qSH-1, RIL1, OsRIL1

Oryzabase Gene Name Synonym(s)

QTL of seed shattering in chromosome 1, RI-LIKE1, erticillate rachis-like 1

Transcript Evidence

AB071330 (Genbank)

AB071331 (Genbank)

Protein Evidence

Q8RUM5 (UniProt)

Q941S9 (UniProt)

Literature

PMID: 30657229

PMID: 16614172

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

May 10, 2019

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Cellular Component: nucleus (GO:0005634)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: sequence-specific DNA binding transcription factor activity (GO:0003700)

Molecular Function: protein binding (GO:0005515)

Molecular Function: sequence-specific DNA binding (GO:0043565)

Functional domain (InterPro)

Homeodomain (IPR001356)

POX (IPR006563)

Homeobox KN domain (IPR008422)

Homeodomain-like (IPR009057)

Full-length cDNA

006-201-C01 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0848400-01)

RiceXPro (AK060936)

Others

Oryzabase (6374)

KEGG (Os01t0848400-01)

Transcript

2442 bp

>Os01t0848400-01 BEL1-type homeobox family, Paralog of RI, Seed shattering, Initiation and maintenance of the shoot apical meristem during embryogenesis, Construction of inflorescence architecture
CGGCCTTTCTGCTTTCGCTTTCACAGTTTCACGGCTTACCATTTCCTTCCCATCTCTCCC
TCCCGCCACCCCCCTCTTTCTCCCCCTCCGTGTCTCGCCTTTGCAGAAAGAAAGGCGCCA
CGAACCCAGCAACAACACCCAGCACAAAGGCGAAACGGGGAAAAAGAGGAGGAAAACAAC
AAGAGGACGCGAGGGGTCGGGGTGGGAGAGGGAGGCTACACTACAGCAGCAGCAGAAGCA
GAGCGGGAGAGTGATGAGGGAGTGAGACCAGGCCAGCCAAGCCAGGCCCGGGCGCTCGGA
AAGTGCGGAGCCGTTTCCCCTCTATCTCCACTCTCTCCAGGGCCAGGTGCTCACTGCGCT
GCGCCTCTTCGCACGCACCACCCGTACTACGTGCCCACCCGCGCGCGCGCCGAGGAGAAG
AGACCCACGACCGTACGTGCGTGCGCGCCATGTCGTCCGCCGCTGGGGGCGGCGGGTACG
GCGGCGGCCAGGGTGGAGGCGCGGAGCACCACCACCACCACCACGGGCACGCCGGTCACC
TCCTGCTCCACCACCATCCGCAGCACGTGGCCGGCGCGGCCGTTGCGGCAGCGGCCGCGG
CGGCGGGCGGGCAGATGTACCACGTGCCCCAGCACAGCCGGCGCGAGAAGCTCCGGTTCC
CGCCGGACGCCGGGGACTCGCCACCGCCTCATGGTCATGGTCATGGTCATGCCCCGCAGC
AGCAGCAGCAGCACGGGTCGTGGCCTCCGCCCCCGGCGTTCTACTCGTACGCGTCCTCGT
CGTCGTCGTACTCCCCGCACAGCCCTACTCTAGCGCAGGCGCAGCTGGTGGCGCACGGGC
TGGCGCCGCCGCTCCCGCAGATCCCGACGCAGAACTTCTCGCTGTCGCTCTCCTCCGCGT
CGTCGAATCCTCCACCACCGCAGGCGCAGCCGAGGAGGCAGCTCGGCGGCCTCGCGCAGG
CCACGGGGCCGTTCGGTCCCTTCACCGGCTACGCCGCCGTGCTCGGCCGGTCCCGTTTCC
TCGGCCCGGCAGAGAAGCTGTTCGAGGAGATCTGCGACGTCGGCGGCGCTGCTTCGCACG
TCGACCGCACCATCTCCGACGAGGGCCTGCTCGACGCGGATCCGATGGACGGCGTCGATC
ATGACGTCGTTGATCACGACCTCGGCGGCGCTGACCGCGCAGCGGCCGACGCTGGCCCCA
TCTCGGGGGCCGAGCAGCAGTGGAAGAAGACGAAGCTCATCTCCATGATGGAAGAGGTTT
GCAAGAGGTACCGGCAGTACTACCAGCAGGTTCAGGCTGTGATGGCCTCGTTCGAGACCG
TCGCCGGGTTCAGCAACGCCGCGCCGTTCGCGGCATTGGCGCTGAGGGCGATGGCGAAGC
ACTTCAAGTGCTTGAAGAGCATGATTCTGAACCAGCTGCGCAACACGAGCAACAAGGTCG
CTGTGAAGGACGGGCTAAACAAGGAGATCGCCGTGTTCGGGCTCGCCGGGGGTAGCAGCG
GCGGCGCCGGCCTCCAGCGAGCGAACAGCGCGAGCGCGTTCGGCCAGCCGCACAATATTT
GGCGCCCACAGAGGGGGCTCCCCGAGCGCGCTGTGTCCGTTTTACGCGCGTGGCTGTTCG
AACACTTCCTGCACCCGTATCCTACCGATGGTGATAAGCAAATGCTAGCAAAACAAACAG
GCTTGACACGCAACCAGGTATCGAACTGGTTTATCAACGCAAGGGTTAGGTTGTGGAAGC
CAATGGTGGAAGAAATTCACAACCTAGAGATGAGGCAAATGCACAAGCACTCGGTGGTTG
ACAAGGGCCAGCATAGCGTGCATCATCAGGCCCAGCATTCTTCGCAGTGCAGCGGGAATC
CCTCCGTTCCTTCGGACTCCCATCCTGGACAGAGCAGCAGCATAACTCGGAACCACAACA
CCGCTGCCTCCCAGGGCTTCCCGGATGAGCTCTCCCAGATGTCCCAGTCCATCCAGGGAC
AGGTGAGCTTCGCATACAACGGGCTGACCTCGCAGCACAACATTGCATCACCACATCATC
AGCACCAGCAGGTCGGCGGTGTTGGTATCGGAGGCGGCAATGGCGGTGTCTCCCTCACCC
TTGGTCTTCACCAGAACAACAGGGTCTGCATCGCCGAGCCTCTCCCGGCTGCTCTCCCGG
CCAACCTAGCTCACCGTTTCGGACTGGAGGAAGTCAGTGACGCCTATGTGATGAGCTCAT
TTGGAGGTCAGGACCGGCATTTCGGGAAGGAGATTGGTGGTCACTTGCTGCATGATTTTG
TCGGGTGATTGTGGCTGCTGCCTCAGGTTGCTGGTGATGCACTTGTAATGTACTGCTAGT
ATGATGTTAGGATGGTATATAAGTCAATCACTTGGCGACATGGCTTGATGATCAGTCTGA
ATCAATTTGTTCGGAGGGTGAAAAAACATTGATCTTCCCTTC

CDS

1839 bp

>Os01t0848400-01 BEL1-type homeobox family, Paralog of RI, Seed shattering, Initiation and maintenance of the shoot apical meristem during embryogenesis, Construction of inflorescence architecture
ATGTCGTCCGCCGCTGGGGGCGGCGGGTACGGCGGCGGCCAGGGTGGAGGCGCGGAGCAC
CACCACCACCACCACGGGCACGCCGGTCACCTCCTGCTCCACCACCATCCGCAGCACGTG
GCCGGCGCGGCCGTTGCGGCAGCGGCCGCGGCGGCGGGCGGGCAGATGTACCACGTGCCC
CAGCACAGCCGGCGCGAGAAGCTCCGGTTCCCGCCGGACGCCGGGGACTCGCCACCGCCT
CATGGTCATGGTCATGGTCATGCCCCGCAGCAGCAGCAGCAGCACGGGTCGTGGCCTCCG
CCCCCGGCGTTCTACTCGTACGCGTCCTCGTCGTCGTCGTACTCCCCGCACAGCCCTACT
CTAGCGCAGGCGCAGCTGGTGGCGCACGGGCTGGCGCCGCCGCTCCCGCAGATCCCGACG
CAGAACTTCTCGCTGTCGCTCTCCTCCGCGTCGTCGAATCCTCCACCACCGCAGGCGCAG
CCGAGGAGGCAGCTCGGCGGCCTCGCGCAGGCCACGGGGCCGTTCGGTCCCTTCACCGGC
TACGCCGCCGTGCTCGGCCGGTCCCGTTTCCTCGGCCCGGCAGAGAAGCTGTTCGAGGAG
ATCTGCGACGTCGGCGGCGCTGCTTCGCACGTCGACCGCACCATCTCCGACGAGGGCCTG
CTCGACGCGGATCCGATGGACGGCGTCGATCATGACGTCGTTGATCACGACCTCGGCGGC
GCTGACCGCGCAGCGGCCGACGCTGGCCCCATCTCGGGGGCCGAGCAGCAGTGGAAGAAG
ACGAAGCTCATCTCCATGATGGAAGAGGTTTGCAAGAGGTACCGGCAGTACTACCAGCAG
GTTCAGGCTGTGATGGCCTCGTTCGAGACCGTCGCCGGGTTCAGCAACGCCGCGCCGTTC
GCGGCATTGGCGCTGAGGGCGATGGCGAAGCACTTCAAGTGCTTGAAGAGCATGATTCTG
AACCAGCTGCGCAACACGAGCAACAAGGTCGCTGTGAAGGACGGGCTAAACAAGGAGATC
GCCGTGTTCGGGCTCGCCGGGGGTAGCAGCGGCGGCGCCGGCCTCCAGCGAGCGAACAGC
GCGAGCGCGTTCGGCCAGCCGCACAATATTTGGCGCCCACAGAGGGGGCTCCCCGAGCGC
GCTGTGTCCGTTTTACGCGCGTGGCTGTTCGAACACTTCCTGCACCCGTATCCTACCGAT
GGTGATAAGCAAATGCTAGCAAAACAAACAGGCTTGACACGCAACCAGGTATCGAACTGG
TTTATCAACGCAAGGGTTAGGTTGTGGAAGCCAATGGTGGAAGAAATTCACAACCTAGAG
ATGAGGCAAATGCACAAGCACTCGGTGGTTGACAAGGGCCAGCATAGCGTGCATCATCAG
GCCCAGCATTCTTCGCAGTGCAGCGGGAATCCCTCCGTTCCTTCGGACTCCCATCCTGGA
CAGAGCAGCAGCATAACTCGGAACCACAACACCGCTGCCTCCCAGGGCTTCCCGGATGAG
CTCTCCCAGATGTCCCAGTCCATCCAGGGACAGGTGAGCTTCGCATACAACGGGCTGACC
TCGCAGCACAACATTGCATCACCACATCATCAGCACCAGCAGGTCGGCGGTGTTGGTATC
GGAGGCGGCAATGGCGGTGTCTCCCTCACCCTTGGTCTTCACCAGAACAACAGGGTCTGC
ATCGCCGAGCCTCTCCCGGCTGCTCTCCCGGCCAACCTAGCTCACCGTTTCGGACTGGAG
GAAGTCAGTGACGCCTATGTGATGAGCTCATTTGGAGGTCAGGACCGGCATTTCGGGAAG
GAGATTGGTGGTCACTTGCTGCATGATTTTGTCGGGTGA

Protein

613 aa

>Os01t0848400-01 BEL1-type homeobox family, Paralog of RI, Seed shattering, Initiation and maintenance of the shoot apical meristem during embryogenesis, Construction of inflorescence architecture
MSSAAGGGGYGGGQGGGAEHHHHHHGHAGHLLLHHHPQHVAGAAVAAAAAAAGGQMYHVP
QHSRREKLRFPPDAGDSPPPHGHGHGHAPQQQQQHGSWPPPPAFYSYASSSSSYSPHSPT
LAQAQLVAHGLAPPLPQIPTQNFSLSLSSASSNPPPPQAQPRRQLGGLAQATGPFGPFTG
YAAVLGRSRFLGPAEKLFEEICDVGGAASHVDRTISDEGLLDADPMDGVDHDVVDHDLGG
ADRAAADAGPISGAEQQWKKTKLISMMEEVCKRYRQYYQQVQAVMASFETVAGFSNAAPF
AALALRAMAKHFKCLKSMILNQLRNTSNKVAVKDGLNKEIAVFGLAGGSSGGAGLQRANS
ASAFGQPHNIWRPQRGLPERAVSVLRAWLFEHFLHPYPTDGDKQMLAKQTGLTRNQVSNW
FINARVRLWKPMVEEIHNLEMRQMHKHSVVDKGQHSVHHQAQHSSQCSGNPSVPSDSHPG
QSSSITRNHNTAASQGFPDELSQMSQSIQGQVSFAYNGLTSQHNIASPHHQHQQVGGVGI
GGGNGGVSLTLGLHQNNRVCIAEPLPAALPANLAHRFGLEEVSDAYVMSSFGGQDRHFGK
EIGGHLLHDFVG*

5'UTR

chr01:36449503..36449951 (- strand) : 449 bp

CDS

chr01:36448696..36449502 (- strand) : 807 bp

chr01:36447492..36447871 (- strand) : 380 bp

chr01:36446308..36446368 (- strand) : 61 bp

chr01:36445610..36446200 (- strand) : 591 bp

3'UTR

chr01:36445456..36445609 (- strand) : 154 bp

FASTA

>Os01t0848400-01 class=Sequence position=chr01:36445456..36449951 (- strand)
CGGCCTTTCT GCTTTCGCTT TCACAGTTTC ACGGCTTACC ATTTCCTTCC CATCTCTCCC TCCCGCCACC CCCCTCTTTC
TCCCCCTCCG TGTCTCGCCT TTGCAGAAAG AAAGGCGCCA CGAACCCAGC AACAACACCC AGCACAAAGG CGAAACGGGG
AAAAAGAGGA GGAAAACAAC AAGAGGACGC GAGGGGTCGG GGTGGGAGAG GGAGGCTACA CTACAGCAGC AGCAGAAGCA
GAGCGGGAGA GTGATGAGGG AGTGAGACCA GGCCAGCCAA GCCAGGCCCG GGCGCTCGGA AAGTGCGGAG CCGTTTCCCC
TCTATCTCCA CTCTCTCCAG GGCCAGGTGC TCACTGCGCT GCGCCTCTTC GCACGCACCA CCCGTACTAC GTGCCCACCC
GCGCGCGCGC CGAGGAGAAG AGACCCACGA CCGTACGTGC GTGCGCGCCA TGTCGTCCGC CGCTGGGGGC GGCGGGTACG
GCGGCGGCCA GGGTGGAGGC GCGGAGCACC ACCACCACCA CCACGGGCAC GCCGGTCACC TCCTGCTCCA CCACCATCCG
CAGCACGTGG CCGGCGCGGC CGTTGCGGCA GCGGCCGCGG CGGCGGGCGG GCAGATGTAC CACGTGCCCC AGCACAGCCG
GCGCGAGAAG CTCCGGTTCC CGCCGGACGC CGGGGACTCG CCACCGCCTC ATGGTCATGG TCATGGTCAT GCCCCGCAGC
AGCAGCAGCA GCACGGGTCG TGGCCTCCGC CCCCGGCGTT CTACTCGTAC GCGTCCTCGT CGTCGTCGTA CTCCCCGCAC
AGCCCTACTC TAGCGCAGGC GCAGCTGGTG GCGCACGGGC TGGCGCCGCC GCTCCCGCAG ATCCCGACGC AGAACTTCTC
GCTGTCGCTC TCCTCCGCGT CGTCGAATCC TCCACCACCG CAGGCGCAGC CGAGGAGGCA GCTCGGCGGC CTCGCGCAGG
CCACGGGGCC GTTCGGTCCC TTCACCGGCT ACGCCGCCGT GCTCGGCCGG TCCCGTTTCC TCGGCCCGGC AGAGAAGCTG
TTCGAGGAGA TCTGCGACGT CGGCGGCGCT GCTTCGCACG TCGACCGCAC CATCTCCGAC GAGGGCCTGC TCGACGCGGA
TCCGATGGAC GGCGTCGATC ATGACGTCGT TGATCACGAC CTCGGCGGCG CTGACCGCGC AGCGGCCGAC GCTGGCCCCA
TCTCGGGGGC CGAGCAGCAG TGGAAGAAGA CGAAGCTCAT CTCCATGATG GAAGAGGTGA GTGAGCTCCG CTAGCCGCCT
CAATTCCTCC TTCCAGGTTT CTTGTGGCGA CCATCTTTTT CACCTTGTTT CGGCGTTACA ATTATCGCTA CTCCTGGGTG
GAGAAGAATC TTGCACATAG TGGTCATGTC ACCGATGCAG TTGCGGATTG CTTTTATTTA CTGTGGTTGC ATGTGCTTTT
GATTTGATGA TGATTTCCTT TGCTGCTGAT ACATCTTTTG ATTTGTTCTC TCTCTTCTTT TTCCTCGAGT GGTTTGAGCT
TGTACAGTTC TGCACTGTTC ATGATGAATA GTAGTGTTCC TCCGCGTCTT ATCACCAAAG ATTGTATTTT GATCGGCTGT
TTAGCACTAC TGTGAGTGCT TGAAAAGATA GTCCTCCACA TGAAATTAGA ACTAACCGTC CTTTCAAAGT CTTGAGACAT
GACCCATGGG CGATGCCAGA TGCCATTAAT TCTCTCTTGT TGGTGTCCTC TGGTGAGAAT AGTGGCGCTG CTAAAAGCTT
CGAGCTTTGA AATGCGCTCT CCTCTACGAT GTCGGAGCAT GGCAATTAGG AGTATACTAC ATGAGCATCT ACGTAGGAGT
ACAATGTAGA AAGCTTCTAT TTTTGGAACC CTCTGTAAGG CAATTTTGTT TGCCTGTGTT CTTCAATAAC ATCTCTCTCC
CATAATTGGG AGCTACGCTT GCTTTGTTCG TGTCATATCC ACATGAAAAC AAAAGCACAC TGCTTCCTTT TCCTAACATG
GATATCTTTT TATCTAATCA TTCTTTGTTG GTAGATTATC TCTCATCGAA TTCTAACCCA ACAGCAATAT CTTTTTTTAG
GTTTGCAAGA GGTACCGGCA GTACTACCAG CAGGTTCAGG CTGTGATGGC CTCGTTCGAG ACCGTCGCCG GGTTCAGCAA
CGCCGCGCCG TTCGCGGCAT TGGCGCTGAG GGCGATGGCG AAGCACTTCA AGTGCTTGAA GAGCATGATT CTGAACCAGC
TGCGCAACAC GAGCAACAAG GTCGCTGTGA AGGACGGGCT AAACAAGGAG ATCGCCGTGT TCGGGCTCGC CGGGGGTAGC
AGCGGCGGCG CCGGCCTCCA GCGAGCGAAC AGCGCGAGCG CGTTCGGCCA GCCGCACAAT ATTTGGCGCC CACAGAGGGG
GCTCCCCGAG CGCGCTGTGT CCGTTTTACG CGCGTGGCTG TTCGAACACT TCCTGCACCC GTAAGCCCTT TGATCTTCTT
ATTGCTTTAT GGTTAACTCT GGGTTCATTA GCTGCACGCA TTCCAAGACA ATGATGATGA TGCTACAGTT GCTTGCTTTA
GATGAGGATA ACAGTAGTCC CTAAGCATTT GTGGTGAGTG TGGTTGTTCC TTTTTGATAT GATCAGTAGT ACGTGACACT
GGAACCGTGG GGTTGATCCG TTGATGGTTT GGTGATAGCA AGCGACCCTG CCTGTCTGAT AGAAGGCTAT GGCCTCATGC
AGGCATGGCT TCCAATCCAT CATTAACATA ACTTTTAAAC CTGTACCTAA CTGTGTGTTG AGCTGTACTA CTAGAGATCA
TACTTTCGAC TTGGTGATCT AAATAGTGGC ATTCCTGCTG CTTGTTTGAT GCATTCTTAA TCACGTATTA ACTTCCTGGA
TTTGTTGTTT CTGGCTGTAA TGTATGAATG TGGTGGCCCG GCTTCTCATA AGTAGAGTGG CTTTTAGAAC ACGTTAATGC
TGGAATTAAC TTGCCAGATG GGCATTACTT CGAACTAAAT CTTAAAAGTA CATACCTTAG GCTATAATAA GCATCATCAT
AATGTAGTTT GTTTGGCATA TTCTTTTTAG TTTTTGTAGT ATGATCATTT TGCATTATAT ATATGATCTA AAGGCTGTAG
CTAAGCCCTA CTGGTGGTTA CATCAAGTTG ATTGACATGT GCTCGAGATA TTCAGTTTGA GATAATTAGT ACAGTAGTTT
AGTGCTAGCC ATTTTCATCC AGTAAGGGGT TTGTCTGTCT GTTTATTACT TTAAAAAAAG GATCAGTCAT CATCTTTAAA
AAAAGTCACT GAAATCCATT ATTTGTCAGA TGTTGGTCCT AGTGTTATTA GTTCCCGTAT TGATCAAATC CTTTGTAAGG
TTCGACTTGG AAGATGTGTT TGCCTACATC TTTGCTTGGA TATTCGCCAT GTAAAATATT TGTTGTGATC CTGTAAACCA
TCGTTAAGCA TGCACATCAC AAGTGTCTTT TGTAATAGCG GAAATTTCTT GATTATTTGA TTTTGCGCTA TATCTGGTAC
TTTGTTCTTT TAGAAAACAC TATAATTTTG CATCAGTGAC ATTTTCAGAT TCCAATCGTG CAGGTATCCT ACCGATGGTG
ATAAGCAAAT GCTAGCAAAA CAAACAGGCT TGACACGCAA CCAGGTAAAT AGAAATGCTT CTAGGTGTGT TCAAGAATAG
ATTGCACAGT ATATCAGGCT AGATTGTTTT GTTTTCAGGA CATTTTGATT GAATTTGTGA TGCTGGTGCA GGTATCGAAC
TGGTTTATCA ACGCAAGGGT TAGGTTGTGG AAGCCAATGG TGGAAGAAAT TCACAACCTA GAGATGAGGC AAATGCACAA
GCACTCGGTG GTTGACAAGG GCCAGCATAG CGTGCATCAT CAGGCCCAGC ATTCTTCGCA GTGCAGCGGG AATCCCTCCG
TTCCTTCGGA CTCCCATCCT GGACAGAGCA GCAGCATAAC TCGGAACCAC AACACCGCTG CCTCCCAGGG CTTCCCGGAT
GAGCTCTCCC AGATGTCCCA GTCCATCCAG GGACAGGTGA GCTTCGCATA CAACGGGCTG ACCTCGCAGC ACAACATTGC
ATCACCACAT CATCAGCACC AGCAGGTCGG CGGTGTTGGT ATCGGAGGCG GCAATGGCGG TGTCTCCCTC ACCCTTGGTC
TTCACCAGAA CAACAGGGTC TGCATCGCCG AGCCTCTCCC GGCTGCTCTC CCGGCCAACC TAGCTCACCG TTTCGGACTG
GAGGAAGTCA GTGACGCCTA TGTGATGAGC TCATTTGGAG GTCAGGACCG GCATTTCGGG AAGGAGATTG GTGGTCACTT
GCTGCATGAT TTTGTCGGGT GATTGTGGCT GCTGCCTCAG GTTGCTGGTG ATGCACTTGT AATGTACTGC TAGTATGATG
TTAGGATGGT ATATAAGTCA ATCACTTGGC GACATGGCTT GATGATCAGT CTGAATCAAT TTGTTCGGAG GGTGAAAAAA
CATTGATCTT CCCTTC