Os01t0854500-01

Locus

Os01g0854500

Description

Homeobox domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

QHB

CGSNL Gene Name

QUIESCENT-CENTER-SPECIFIC-HOMEOBOX (QHB) GENE

Oryzabase Gene Symbol Synonym(s)

OsWOX9, WOX9, WOX5, Os WOX5, OsWOX5, QHB/OsWOX9

Oryzabase Gene Name Synonym(s)

quiescent-center-specific-homeobox (QHB) gene, WUSCHEL-related homeobox 9, Protein WOX5, Quiescent-specific homeobox protein

Transcript Evidence

AK102203 (DDBJ, Best hit)

Protein Evidence

Q8W0F1 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: sequence-specific DNA binding transcription factor activity (GO:0003700)

Molecular Function: protein binding (GO:0005515)

Molecular Function: sequence-specific DNA binding (GO:0043565)

Functional domain (InterPro)

Homeobox (IPR001356)

Homeodomain-like (IPR009057)

Homeodomain-related (IPR012287)

Full-length cDNA

J033087F22 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0854500-01)

RiceXPro (AK102203)

Others

Oryzabase (3118)

KEGG (Os01t0854500-01)

Transcript

1179 bp

>Os01t0854500-01 Homeobox domain containing protein.
AGCATTGCTTCTGATCAGAAGAAGATCCCGGAAGAGACCAAATCAGAAGCTAAACCTATC
TACCACAAGGCCAAGTTACGTTAGACCGTTTTGATCAGTGAATTAGCTTTCAAGCAGTTC
TACTGCTCCCAGCCGCTCGATCGATCGATCGATCAAACAAGGTAGCTAGCTAGCTCAGGA
TCAAATCTGGTTTGTCTACATATATAGGTAGTGATCGATCAGTCGGTCGGTCATGGAGGC
TCTTAGCGGGCGAGTGGGGGTGAAGTGTGGGCGGTGGAACCCGACGGCGGAGCAGGTGAA
GGTCCTGACGGAGCTGTTCCGAGCGGGGTTGCGGACGCCGAGCACGGAGCAGATCCAGCG
CATCTCCACTCACCTCAGCGCATTCGGCAAGGTGGAGAGCAAGAACGTCTTCTACTGGTT
CCAGAACCACAAGGCCCGCGAGCGCCACCACCACAAGAAGCGCCGCCGCGGCGCCTCCTC
CCCCGACAGCGGCAGCAACGATGACGATGGCCGCGCCGCAGCCCACGAGGGCGACGCCGA
CCTCGTCCTGCAGCCTCCTGAGAGCAAGCGGGAGGCCAGAAGCTACGGCCATCATCACCG
GCTCATGACATGCTACGTGAGGGATGTGGTGGAGACGGAAGCGATGTGGGAGCGGCCGAC
GAGGGAGGTGGAAACGCTGGAGCTGTTCCCACTCAAGTCGTATGACCTCGAGGTGGACAA
GGTCCGGTATGTGAGGGGCGGCGGTGGCGAGCAGTGCAGGGAGATCTCGTTCTTCGACGT
CGCTGCCGGCCGGGATCCGCCGCTGGAGCTCAGGCTTTGCAGCTTCGGCCTCTAGATCGA
CCCGTGCATTGATGTGCCGCACATATGGCATGAGATGCAGCTTGCCGCGACTGTACCTGG
CCTCTTGTCGCTGTGCCTAGTCCTAGTTCTAGCTGCCCCACATCAAAAGGAGTACGTACG
AGATGTCATGAGATACGGCATGTGTTGTGGGAAAGTCCGTTGTTGCATGCAGTATCTGGG
AGGATCAGGAAAGAGCACGCAAACGAGATTTCCCCATTGCCCTTTTCCTTGGTCTTTCCA
TCATGAGATGTACTTCTACTTTTCTTCTTTTCTGCTACATGGATACTAACATGGTCACTG
CTGATACTTCTATATGATATATCCATTAATTAATATTCC

CDS

603 bp

>Os01t0854500-01 Homeobox domain containing protein.
ATGGAGGCTCTTAGCGGGCGAGTGGGGGTGAAGTGTGGGCGGTGGAACCCGACGGCGGAG
CAGGTGAAGGTCCTGACGGAGCTGTTCCGAGCGGGGTTGCGGACGCCGAGCACGGAGCAG
ATCCAGCGCATCTCCACTCACCTCAGCGCATTCGGCAAGGTGGAGAGCAAGAACGTCTTC
TACTGGTTCCAGAACCACAAGGCCCGCGAGCGCCACCACCACAAGAAGCGCCGCCGCGGC
GCCTCCTCCCCCGACAGCGGCAGCAACGATGACGATGGCCGCGCCGCAGCCCACGAGGGC
GACGCCGACCTCGTCCTGCAGCCTCCTGAGAGCAAGCGGGAGGCCAGAAGCTACGGCCAT
CATCACCGGCTCATGACATGCTACGTGAGGGATGTGGTGGAGACGGAAGCGATGTGGGAG
CGGCCGACGAGGGAGGTGGAAACGCTGGAGCTGTTCCCACTCAAGTCGTATGACCTCGAG
GTGGACAAGGTCCGGTATGTGAGGGGCGGCGGTGGCGAGCAGTGCAGGGAGATCTCGTTC
TTCGACGTCGCTGCCGGCCGGGATCCGCCGCTGGAGCTCAGGCTTTGCAGCTTCGGCCTC
TAG

Protein

201 aa

>Os01t0854500-01 Homeobox domain containing protein.
MEALSGRVGVKCGRWNPTAEQVKVLTELFRAGLRTPSTEQIQRISTHLSAFGKVESKNVF
YWFQNHKARERHHHKKRRRGASSPDSGSNDDDGRAAAHEGDADLVLQPPESKREARSYGH
HHRLMTCYVRDVVETEAMWERPTREVETLELFPLKSYDLEVDKVRYVRGGGGEQCREISF
FDVAAGRDPPLELRLCSFGL*

5'UTR

chr01:36814792..36815023 (- strand) : 232 bp

CDS

chr01:36814413..36814791 (- strand) : 379 bp

chr01:36814080..36814303 (- strand) : 224 bp

3'UTR

chr01:36813736..36814079 (- strand) : 344 bp

FASTA

>Os01t0854500-01 class=Sequence position=chr01:36813736..36815023 (- strand)
AGCATTGCTT CTGATCAGAA GAAGATCCCG GAAGAGACCA AATCAGAAGC TAAACCTATC TACCACAAGG CCAAGTTACG
TTAGACCGTT TTGATCAGTG AATTAGCTTT CAAGCAGTTC TACTGCTCCC AGCCGCTCGA TCGATCGATC GATCAAACAA
GGTAGCTAGC TAGCTCAGGA TCAAATCTGG TTTGTCTACA TATATAGGTA GTGATCGATC AGTCGGTCGG TCATGGAGGC
TCTTAGCGGG CGAGTGGGGG TGAAGTGTGG GCGGTGGAAC CCGACGGCGG AGCAGGTGAA GGTCCTGACG GAGCTGTTCC
GAGCGGGGTT GCGGACGCCG AGCACGGAGC AGATCCAGCG CATCTCCACT CACCTCAGCG CATTCGGCAA GGTGGAGAGC
AAGAACGTCT TCTACTGGTT CCAGAACCAC AAGGCCCGCG AGCGCCACCA CCACAAGAAG CGCCGCCGCG GCGCCTCCTC
CCCCGACAGC GGCAGCAACG ATGACGATGG CCGCGCCGCA GCCCACGAGG GCGACGCCGA CCTCGTCCTG CAGCCTCCTG
AGAGCAAGCG GGAGGCCAGA AGCTACGGCC ATCATCACCG GCTCATGACA TGTAAGCATA CATACTTTGA TTAATTATTT
CGCCTATATA CATGCATACG TACGCATGAA TACCCATGAT CGAATAGCTG ATCAAGTTGC TGTTCGATCC GCGCTTGCAG
GCTACGTGAG GGATGTGGTG GAGACGGAAG CGATGTGGGA GCGGCCGACG AGGGAGGTGG AAACGCTGGA GCTGTTCCCA
CTCAAGTCGT ATGACCTCGA GGTGGACAAG GTCCGGTATG TGAGGGGCGG CGGTGGCGAG CAGTGCAGGG AGATCTCGTT
CTTCGACGTC GCTGCCGGCC GGGATCCGCC GCTGGAGCTC AGGCTTTGCA GCTTCGGCCT CTAGATCGAC CCGTGCATTG
ATGTGCCGCA CATATGGCAT GAGATGCAGC TTGCCGCGAC TGTACCTGGC CTCTTGTCGC TGTGCCTAGT CCTAGTTCTA
GCTGCCCCAC ATCAAAAGGA GTACGTACGA GATGTCATGA GATACGGCAT GTGTTGTGGG AAAGTCCGTT GTTGCATGCA
GTATCTGGGA GGATCAGGAA AGAGCACGCA AACGAGATTT CCCCATTGCC CTTTTCCTTG GTCTTTCCAT CATGAGATGT
ACTTCTACTT TTCTTCTTTT CTGCTACATG GATACTAACA TGGTCACTGC TGATACTTCT ATATGATATA TCCATTAATT
AATATTCC

Locus: Os01g0854500

Loading...

Locus: Os01g0854500

Loading...