Os01t0856500-01

Locus

Os01g0856500

Description

Auxin transporter, Primary root and root hair elongation, Cd stress response

RAP-DB Gene Symbol Synonym(s)

OsLAX1, OsRAU1, OsAUX1

RAP-DB Gene Name Synonym(s)

like aux1-1, related to AUX1-1, auxin transporter 1

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsLAX1, OsRAU1, OsAUX1, LAX1, RAU1, AUX1

Oryzabase Gene Name Synonym(s)

like aux1-1, related to AUX1-1, auxin transporter 1

Transcript Evidence

AK100090

Protein Evidence

Q5N892

Literature

PMID: 26140668

PMID: 25311360

Note

Manual Curation

September 2, 2015

Functional domain (InterPro)

Amino acid transporter, transmembrane domain (IPR013057)

Full-length cDNA

J023003J03 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0856500-01)

RiceXPro (AK100090)

Others

Oryzabase (11916)

KEGG (Os01t0856500-01)

Transcript

2405 bp

>Os01t0856500-01 Auxin transporter, Primary root and root hair elongation, Cd stress response
ATCTTCCTCTTCCCTCCCCTCTCTCTCCATCACCAGCTCATCCCTCTCTAGCGCTCGTTC
GCCCGCCCCTCCCCCCTACGGCCCTACGAGCGCCGCGCTTCTCTTTCTAGCCCCCTCTTC
CGCATTACTCCCTCATAAAGGAGGAACAGAGGAAAGACTGGGCAGAGGAGAGGACCTATA
GCTGAGAAGAAGCAGAGCAAGTGAAGGAGAAAGCCCCGTAATCTTGGCCATCCTCCTCCT
CCTGCTGCTGCTGCAACTCCGGCTCTGCCTTTAAACAGTGCAGCCCGGGCGGCGCCGGCC
ACGACGCTCGTACTCCTAGCTAGCAGCGGAGAACGAACAGCGTGCAGGGACTCGCCTCGA
TAGCACAGTAAATTCCATTCCATATCATATACCATTCCAGCCATCACTCTCCACCGGCAC
CCTGCATTTACTGCTCCCCCATCACTCGCCCCGGCTTCCTTGAGCGCGATCTCCAGATCA
TCTTTTGTGTAGCGAGAAAGCTGACGACGGGGAAGGGCGGCGTGGTCAGCATGGTGCCGC
GCGAGCAGGCGGAGGAggccatcgtggctgacagcaacggcaaggaggaggaggtcgggg
tgatgggcgtcagcgccGGGGAGCACGGCGCCGACGACCACCACGGCGGCGGCGGCAAGT
TCAGCATGAAGAACCTGCTCTGGCACGGCGGCTCCGTCTGGGACGCCTGGTTCAGCTGCG
CCTCTAACCAGGTCGCGCAGGTGCTCCTGACGCTGCCGTACTCCTTCTCGCAGCTCGGGA
TGCTCTCGGGCGTGCTGCTGCAGCTGTTCTACGGTTTCATGGGCAGCTGGACCGCCTACC
TAATCAGCGTCCTCTACGTCGAGTACCGCTCCCGCAAGGAGAAGGAAGGCGTCAGCTTCA
AGAACCACGTCATCCAGTGGTTCGAGGTGCTGGATGGGCTACTGGGCCCGTACTGGAAGG
CGGCCGGACTCGCCTTCAACTGCACGTTCCTCCTCTTCGGCTCCGTCATCCAGCTGATCG
CCTGCGCGAGTAACATCTACTACATCAACGACCGGCTGGACAAGCGGACGTGGACGTACA
TCTTCGGCGCGTGCTGCGCCACCACGGTGTTCATCCCGTCGTTCCACAACTACCGGATCT
GGTCCTTCCTGGGCCTCGGCATGACCACCTATACCGCTTGGTACCTCGCCATCGCCGCCC
TCCTCAACGGCCAGGCCGAAGGCATCACCCACACCGGTCCAACCAAGCTGGTGCTGTACT
TCACCGGCGCCACCAACATCCTCTACACCTTCGGCGGCCACGCCGTCACAGTGGAGATCA
TGCACGCGATGTGGAAACCGGCCAAGTTCAAGTACATCTACCTGCTGGCGACGCTGTACG
TGTTCACGCTGACGCTGCCGTCGGCGTCGGCCATGTACTGGGCGTTCGGGGACGAGCTGC
TGACCCACTCCAACGCCTTCTCGCTGCTGCCCAAGACCGGGTGGCGCGACGCGGCGGTGA
TACTGATGCTGATCCACCAGTTCATCACGTTCGGGTTCGCGTGCACGCCGCTCTACTTCG
TGTGGGAGAAGGTGATCGGCATGCACGACACCAAGAGCATCTGCCTCAGGGCGCTCGCGC
GGCTCCCCATCGTCGTCCCCATCTGGTTCCTCGCCATCATCTTCCCCTTCTTCGGCCCCA
TCAACTCCGCCGTCGGCGCGCTCCTCGTCAGCTTCACCGTCTACATCATCCCGGCACTCG
CCCACATCCTCACCTACCGTACGGCCTCCGCGCGCATGAACGCGGCGGAGAAGCCACCGT
TCTTCCTGCCGAGCTGGACGGGGATGTTCGTGCTCAACATGTTCATCGTGGTGTGGGTGC
TCGTGGTGGGCTTCGGGCTCGGCGGCTGGGCCAGCATGGTCAACTTCATCAGGCAGATCG
ACACGTTCGGGCTCTTCGCCAAGTGCTACCAGTGTCCCAAGCCCGCCCCGGCGTTGGCGC
AGTCGCCGGTGCCATTGCCGCACCACTAGCGCGCGCCCGTTCCGCACCACCGCCGCCGCC
GCGGCGGACCGTGACAACGTGCACCGCCGAGCCCGGAGCAAGGAACCTCGCTCTCCTGGC
CGGCACGGCTGCAAAAATTCAGTGTTGCTTAGGTTTTGGTCGCCTTGTAATATACAAAGC
CTCTCCTCCTGTGCTAGGGTGTCACACCAAAATGGTAGAAGAAGAAGAGGGCATGGGTCC
CTACGATCTTGCCCCGGGCCGTCCGCTGCCGCGTTGCTTTCCCCCGATCCTCGATGGTGT
CCTTGTGTTTGTTTGGCTTGCCCCTCCCTCTGGCGATATATATGTGATGGTCGTCATGGC
TTATAAAGATTTTCAGCTCATGTCACATTTTCATATGATATGATGTAGCATATCACTATA
GGGTT

CDS

1479 bp

>Os01t0856500-01 Auxin transporter, Primary root and root hair elongation, Cd stress response
ATGGTGCCGCGCGAGCAGGCGGAGGAggccatcgtggctgacagcaacggcaaggaggag
gaggtcggggtgatgggcgtcagcgccGGGGAGCACGGCGCCGACGACCACCACGGCGGC
GGCGGCAAGTTCAGCATGAAGAACCTGCTCTGGCACGGCGGCTCCGTCTGGGACGCCTGG
TTCAGCTGCGCCTCTAACCAGGTCGCGCAGGTGCTCCTGACGCTGCCGTACTCCTTCTCG
CAGCTCGGGATGCTCTCGGGCGTGCTGCTGCAGCTGTTCTACGGTTTCATGGGCAGCTGG
ACCGCCTACCTAATCAGCGTCCTCTACGTCGAGTACCGCTCCCGCAAGGAGAAGGAAGGC
GTCAGCTTCAAGAACCACGTCATCCAGTGGTTCGAGGTGCTGGATGGGCTACTGGGCCCG
TACTGGAAGGCGGCCGGACTCGCCTTCAACTGCACGTTCCTCCTCTTCGGCTCCGTCATC
CAGCTGATCGCCTGCGCGAGTAACATCTACTACATCAACGACCGGCTGGACAAGCGGACG
TGGACGTACATCTTCGGCGCGTGCTGCGCCACCACGGTGTTCATCCCGTCGTTCCACAAC
TACCGGATCTGGTCCTTCCTGGGCCTCGGCATGACCACCTATACCGCTTGGTACCTCGCC
ATCGCCGCCCTCCTCAACGGCCAGGCCGAAGGCATCACCCACACCGGTCCAACCAAGCTG
GTGCTGTACTTCACCGGCGCCACCAACATCCTCTACACCTTCGGCGGCCACGCCGTCACA
GTGGAGATCATGCACGCGATGTGGAAACCGGCCAAGTTCAAGTACATCTACCTGCTGGCG
ACGCTGTACGTGTTCACGCTGACGCTGCCGTCGGCGTCGGCCATGTACTGGGCGTTCGGG
GACGAGCTGCTGACCCACTCCAACGCCTTCTCGCTGCTGCCCAAGACCGGGTGGCGCGAC
GCGGCGGTGATACTGATGCTGATCCACCAGTTCATCACGTTCGGGTTCGCGTGCACGCCG
CTCTACTTCGTGTGGGAGAAGGTGATCGGCATGCACGACACCAAGAGCATCTGCCTCAGG
GCGCTCGCGCGGCTCCCCATCGTCGTCCCCATCTGGTTCCTCGCCATCATCTTCCCCTTC
TTCGGCCCCATCAACTCCGCCGTCGGCGCGCTCCTCGTCAGCTTCACCGTCTACATCATC
CCGGCACTCGCCCACATCCTCACCTACCGTACGGCCTCCGCGCGCATGAACGCGGCGGAG
AAGCCACCGTTCTTCCTGCCGAGCTGGACGGGGATGTTCGTGCTCAACATGTTCATCGTG
GTGTGGGTGCTCGTGGTGGGCTTCGGGCTCGGCGGCTGGGCCAGCATGGTCAACTTCATC
AGGCAGATCGACACGTTCGGGCTCTTCGCCAAGTGCTACCAGTGTCCCAAGCCCGCCCCG
GCGTTGGCGCAGTCGCCGGTGCCATTGCCGCACCACTAG

Protein

493 aa

>Os01t0856500-01 Auxin transporter, Primary root and root hair elongation, Cd stress response
MVPREQAEEAIVADSNGKEEEVGVMGVSAGEHGADDHHGGGGKFSMKNLLWHGGSVWDAW
FSCASNQVAQVLLTLPYSFSQLGMLSGVLLQLFYGFMGSWTAYLISVLYVEYRSRKEKEG
VSFKNHVIQWFEVLDGLLGPYWKAAGLAFNCTFLLFGSVIQLIACASNIYYINDRLDKRT
WTYIFGACCATTVFIPSFHNYRIWSFLGLGMTTYTAWYLAIAALLNGQAEGITHTGPTKL
VLYFTGATNILYTFGGHAVTVEIMHAMWKPAKFKYIYLLATLYVFTLTLPSASAMYWAFG
DELLTHSNAFSLLPKTGWRDAAVILMLIHQFITFGFACTPLYFVWEKVIGMHDTKSICLR
ALARLPIVVPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPALAHILTYRTASARMNAAE
KPPFFLPSWTGMFVLNMFIVVWVLVVGFGLGGWASMVNFIRQIDTFGLFAKCYQCPKPAP
ALAQSPVPLPHH*

5'UTR

chr01:36998338..36998837 (+ strand) : 500 bp

chr01:36998987..36999016 (+ strand) : 30 bp

CDS

chr01:36999017..36999217 (+ strand) : 201 bp

chr01:36999350..36999535 (+ strand) : 186 bp

chr01:36999956..37000068 (+ strand) : 113 bp

chr01:37000245..37000428 (+ strand) : 184 bp

chr01:37000540..37000637 (+ strand) : 98 bp

chr01:37002304..37002769 (+ strand) : 466 bp

chr01:37003886..37004116 (+ strand) : 231 bp

3'UTR

chr01:37004117..37004512 (+ strand) : 396 bp

FASTA

>Os01t0856500-01 class=Sequence position=chr01:36998338..37004512 (+ strand)
ATCTTCCTCT TCCCTCCCCT CTCTCTCCAT CACCAGCTCA TCCCTCTCTA GCGCTCGTTC GCCCGCCCCT CCCCCCTACG
GCCCTACGAG CGCCGCGCTT CTCTTTCTAG CCCCCTCTTC CGCATTACTC CCTCATAAAG GAGGAACAGA GGAAAGACTG
GGCAGAGGAG AGGACCTATA GCTGAGAAGA AGCAGAGCAA GTGAAGGAGA AAGCCCCGTA ATCTTGGCCA TCCTCCTCCT
CCTGCTGCTG CTGCAACTCC GGCTCTGCCT TTAAACAGTG CAGCCCGGGC GGCGCCGGCC ACGACGCTCG TACTCCTAGC
TAGCAGCGGA GAACGAACAG CGTGCAGGGA CTCGCCTCGA TAGCACAGTA AATTCCATTC CATATCATAT ACCATTCCAG
CCATCACTCT CCACCGGCAC CCTGCATTTA CTGCTCCCCC ATCACTCGCC CCGGCTTCCT TGAGCGCGAT CTCCAGATCA
TCTTTTGTGT AGCGAGAAAG GTTGGTGCTC TTCTTCTTCT TCTTCTTGCT GCTGCAGCTG GTGGTGTTGT TTTTTTTATT
GGCGGGGTCG GTTTCCTGCT CTGTTTTGTT AAGTCATATT GTGCTGTCCT GGATCTTGAT CCGACGTCCG TCCGTACGCA
CTCACGCAGC TGACGACGGG GAAGGGCGGC GTGGTCAGCA TGGTGCCGCG CGAGCAGGCG GAGGAggcca tcgtggctga
cagcaacggc aaggaggagg aggtcggggt gatgggcgtc agcgccGGGG AGCACGGCGC CGACGACCAC CACGGCGGCG
GCGGCAAGTT CAGCATGAAG AACCTGCTCT GGCACGGCGG CTCCGTCTGG GACGCCTGGT TCAGCTGCGC CTCTAACCAG
GTATAACTCA TCCTGCTCCG CCATGGCCGC CATCGCGGCC ATGCAGCTCG CTCGATGAAG GAATCATATC GAGACGAATC
CGAAAGGCAG CGTGACTGAA TTTCTGAATT TCCTGGTGGT GGGTTTCTGC AGGTCGCGCA GGTGCTCCTG ACGCTGCCGT
ACTCCTTCTC GCAGCTCGGG ATGCTCTCGG GCGTGCTGCT GCAGCTGTTC TACGGTTTCA TGGGCAGCTG GACCGCCTAC
CTAATCAGCG TCCTCTACGT CGAGTACCGC TCCCGCAAGG AGAAGGAAGG CGTCAGCTTC AAGAACCACG TCATCCAGGT
ACCCGCCCCG CCTTGTCATG CCATGGCCGT GCTGGCCTTG TCGCTTCTTC GTATCCTCCT CCTCATCAGT AACGGATTGT
TACAGCTTCT TATCCCCGTC TTTATGTGGC ATAATCGAAA ACACATTTTT CTCGAGCACG CATTTTTTCC CCTTCCGTTT
GGTCGTTTTC GATCCTTACT GGCTTGAAAA ATGCCTCCTT TTCTTTTGTG AAAATGGCAG GGGGTATTGG ATCCCCTGCC
TCCCATGGCT CTCTTCTGGT TGCTTGCCGA AATGAAAGCC GAGCCTGAAT CGAGCTCATC CTTAATCCTT GTTCAATTAA
TCACTTATTA CTGCAAATTT TGCATAACTA CACAACTATA GTTACTATAC TAACAACTGG GGCTAATGGG AGAAGCTTGT
GACGTTGACT GGTGGCAGTG GTTCGAGGTG CTGGATGGGC TACTGGGCCC GTACTGGAAG GCGGCCGGAC TCGCCTTCAA
CTGCACGTTC CTCCTCTTCG GCTCCGTCAT CCAGCTGATC GCCTGCGCGA GGTCAAATTC CTTTCCTCCC CAACTCAACC
AACCAACCAT CACTCTCCCA CTGTCACTTC GCAGCGCCAG TGTAAATATG TAGCCGTGCT GCTGCGCAAC AGTGTGTCGT
GGTGACAGAT TGGGTTTGTG CGGATGGGCT GAAAACCTGA CCGATAATTT GGTGGTGTTT TCTTCAGTAA CATCTACTAC
ATCAACGACC GGCTGGACAA GCGGACGTGG ACGTACATCT TCGGCGCGTG CTGCGCCACC ACGGTGTTCA TCCCGTCGTT
CCACAACTAC CGGATCTGGT CCTTCCTGGG CCTCGGCATG ACCACCTATA CCGCTTGGTA CCTCGCCATC GCCGCCCTCC
TCAACGGCCA GGTGAGATAA GAAGAGGGAA ACTGTCCTTG TCACTTTCTC GATCATCCAT CGCGTCTACT ACATGTCCAT
TTAGCTTGGG TTTGCAGTGA CTGATGATCG TTTGCGTCGC AGGCCGAAGG CATCACCCAC ACCGGTCCAA CCAAGCTGGT
GCTGTACTTC ACCGGCGCCA CCAACATCCT CTACACCTTC GGCGGCCACG CCGTCACAGT GTAAGCAAAG CAGAACTTGC
TCTGTTTGTC CAGTTGTTAA TACTGTACAG TAGTATTAGT ACTAGGACTA CAAGCTAATC CTCCTGAGGA AGTGAAGTGA
GGGAGAACTT TTCACTAGCT GCAGCTTTTG CCTGCCAATG TGGAGGACAT GTCCCGATTG GAAATCAGGT TCTGGTTTCC
ATTCCATTGG TCCCCCTCCA TGGTACTGGT ACTCGCACCT CACTGGTCAC AGTGTAGTAT AGTGAGTACT ACTACTACTA
CTAAGCTTAA TTAAAACACA CGTAGCTGTA GCTTTGCAGC TAGTTAGCTC TATGGCGTAC AGATCCCAAT GGATGGATAG
GGGCACTTAA AAATTCCAAG CCTGTGCGCG GTGGGAAACA GCTGCGTTAG CTTGCGACCA TTAGTCGGCT GATCGATTGA
TATCGGTCGA TAAAAATTTA TAAAGATCGA TCCAGCTGCT AAAGCTCGGT GCGTTCATGT GCATGTGCGA TGTGCTGAAC
TGGTGATGCA TCCAAAAGGT CCCCTGCTAG TACACGCGAT GGTTTAGGGG AGAAAAGAAT GGGCCACTAT GCATTAGAAT
AGACTCCTTG AGCCCCTTTA TTCCCATTGC TCGTTTATGT GCCTAATCTA TTGCTTGGAT TATTGAGTGT GTTTTTGCTT
TGGCATGATT AGAGGCCCAT GCGAGGAATA ATTAGCGTTT CAGTGCGCTG TTCCTTCAAA ATGCGATGGT CGTTAGTGCC
TTAGTGGTCG CATGCAGTTC GGATTGGAGA TTTGATGATC TTATAGTAGT ATATATAGTA TCTCCTAGCT TCAAAAATTT
AATGTAGTGC TACCAGTACT TGTTCCATAG TTGTGAAAAT TGAAAATGCT TTTGATGGGT TGGAAATGGA ATGGAATGAT
AAGGGGGGCC AGCTTCATTC AATTCAGCTA GTGCGGAGTT CACATCAAGC TATGCAATTC CGTGCTAGTT GCCCTAATCC
AACGGGGTGA AATGATTTCC ATCATGGATT GGGACATCTT GGTGCCAAAT CATCCAATGA TGATTCCATT TATATCTTAC
TACTACTATT ATGCTGCTAG GCTTGCATGG GAAAGTTTAG CTTAGTGGGG CGAAGGGGAC ACAGACCTGC TTTGAGAATT
GCTTCCCAAT TGAAGAATGT GAGTGTCTTT GTCCATCTTG ACAATGCCCC TCACCACTTC TGGTCTCAGG CTAATTCAAA
GCCCAGTTTG GTAGCGACAT GAGACCATTA GCATAACATG CATGGGATGG GATCTTCGCT AGCTGTGGAG CAGAGTTTTT
AGGTGATTAG TACTCGTATT TAGTGGTATA AATTATTATT GGCAACGGCC TTATTTGGCC GTATTTGTCG GCTCCTCCAT
CATTTGACCG GTGGCGGATA CATGTGTTGG TGAAAGAAAG AAAGCAATTG CGAGATTCCC CCTGCCGCCG CGATCCTTGC
ATGTATCCTG CCTGCGTGAC TAGGAGAAGC AGCAGCTGTA GTAGTAGTCC TACTTTTTGG CCGTATCATT TGATCAAGCT
GATTAAAGTC TCAGCATCAT TGACTCGCAT GTGCCGAGGC CGTTTTGTCC GTTGATTTGT TGATTAATAA CCTGCAAGAA
AAGAAAATAA TGACTGATTG GGGGTGGCTG TTTTGGATTG GTGCAGGGAG ATCATGCACG CGATGTGGAA ACCGGCCAAG
TTCAAGTACA TCTACCTGCT GGCGACGCTG TACGTGTTCA CGCTGACGCT GCCGTCGGCG TCGGCCATGT ACTGGGCGTT
CGGGGACGAG CTGCTGACCC ACTCCAACGC CTTCTCGCTG CTGCCCAAGA CCGGGTGGCG CGACGCGGCG GTGATACTGA
TGCTGATCCA CCAGTTCATC ACGTTCGGGT TCGCGTGCAC GCCGCTCTAC TTCGTGTGGG AGAAGGTGAT CGGCATGCAC
GACACCAAGA GCATCTGCCT CAGGGCGCTC GCGCGGCTCC CCATCGTCGT CCCCATCTGG TTCCTCGCCA TCATCTTCCC
CTTCTTCGGC CCCATCAACT CCGCCGTCGG CGCGCTCCTC GTCAGCTTCA CCGTCTACAT CATCCCGGCA CTCGCCCACA
TCCTCACCTA CCGTACGGCC TCCGCGCGCA TGGTAACCTC AAGAACCTCT CTGCACATGC CCTAACTATG CCCCATCATC
ATCGCTGCAT GCATGTTTTT GTTCCGGTAC ACCGCCTCGT CCATCCATCC ACGCATTCAA TGGCAGGTAC TAGTGCAAGC
TAGGGCGAAT GCAACGTGAC GGCCAACTTA TACTAACAAC TGGGTCCGAT GGATTTCATC GACGCTTCCT CCGTGTTGCT
ATAGCTGAGC AGCGGATCGG TCGAGCCATC ATCAACAGTG GCGAGACTGG AACACACAGG CAATAGAATA GACAGTGGAG
ATCTGTGCGC AGGCAGCAGA AGCAAGCAGC AGTTCGTGTT GAATGCAAAA GCACAGCCGG GCCGTGCCCG GGGCCCACCT
CATACATGGG CAAATCCCCA ATCATTGAAT CCAGCCAACA ACCACATTAA TTCCAAGCAG CGCCCCCCCC CCCCCCCCCC
TCCCCTCTCG ATTCTGGCCG CTGCTTTGGC AGTATCTTCC CCAAGAGAGG TTAGCTTAGC CTAGTCACTT TGGTTTAGTG
ACCGTGCCCA GTTCTGGTGC GCTACTGCTC CCATGTATAG TGTCTCAGAT TAGGAGCCCA ACCAAAGGTG GTCCCTGCTT
ATCTGGCTGG CTGCTGCCGC GCGGCTCGGT ACAGCGGACG AATCCACCCG TAGACTCTCT GTGCACCGTG CGCGACGACG
CGAAGAAACG CGCGGAAAGC AACGGTTGAC GCCGCGGTGG ATGAGGTGGG ACGGACGCGC TGCTGATGTT TTCGCGCCGG
CGCTGCTATC GCGGGTGGGA CATATGTAAG ACTTCCGCTT GGCGCGTAGC CGGAGGCGAT GGCGCGGTGG TCGCCGTCGC
GCCCGTCAGG TCAGGGGGCG CGCGCGGCTA GCTTAGCTTT TTTCGCGCGT GGGGGGAGGG GTTTGGGAGA TTTTTGTGCG
TGGGTAGCCT TTCCCTCTCG ATCCCCTTCC TTTTTCCGCG CCTTTCCGAA AGGCGATCGA CCGAACGTGC GTGGTAGTAC
GGACGCGGCA CGGCGAATAA AACCAGCAAG CACCAACCAT GTTTTATGTT GAGAATCTAC AATACGCATC TCTTTTTTGA
CGAGGGTTTA TGTTGTTGTT TGCAACAGAA CGCGGCGGAG AAGCCACCGT TCTTCCTGCC GAGCTGGACG GGGATGTTCG
TGCTCAACAT GTTCATCGTG GTGTGGGTGC TCGTGGTGGG CTTCGGGCTC GGCGGCTGGG CCAGCATGGT CAACTTCATC
AGGCAGATCG ACACGTTCGG GCTCTTCGCC AAGTGCTACC AGTGTCCCAA GCCCGCCCCG GCGTTGGCGC AGTCGCCGGT
GCCATTGCCG CACCACTAGC GCGCGCCCGT TCCGCACCAC CGCCGCCGCC GCGGCGGACC GTGACAACGT GCACCGCCGA
GCCCGGAGCA AGGAACCTCG CTCTCCTGGC CGGCACGGCT GCAAAAATTC AGTGTTGCTT AGGTTTTGGT CGCCTTGTAA
TATACAAAGC CTCTCCTCCT GTGCTAGGGT GTCACACCAA AATGGTAGAA GAAGAAGAGG GCATGGGTCC CTACGATCTT
GCCCCGGGCC GTCCGCTGCC GCGTTGCTTT CCCCCGATCC TCGATGGTGT CCTTGTGTTT GTTTGGCTTG CCCCTCCCTC
TGGCGATATA TATGTGATGG TCGTCATGGC TTATAAAGAT TTTCAGCTCA TGTCACATTT TCATATGATA TGATGTAGCA
TATCACTATA GGGTT

Locus: Os01g0856500

Loading...

Locus: Os01g0856500

Loading...