Os01t0856500-02

Locus

Os01g0856500

Description

Amino acid transporter, transmembrane domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsLAX1, OsRAU1, OsAUX1, LAX1, RAU1, AUX1

Oryzabase Gene Name Synonym(s)

like aux1-1, related to AUX1-1, auxin transporter 1

Transcript Evidence

AK103239 (DDBJ, Best hit)

Protein Evidence

NP_001151566.1 (RefSeq)

Literature

Note

Manual Curation

Functional domain (InterPro)

Amino acid transporter, transmembrane (IPR013057)

Full-length cDNA

J033123G17 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0856500-02)

RiceXPro (AK103239)

Others

Oryzabase (11916)

KEGG (Os01t0856500-02)

Transcript

1967 bp

>Os01t0856500-02 Amino acid transporter, transmembrane domain containing protein.
ACTCTCCACCGGCACCCTGCATTTACTGCTCCCCCATCACTCGCCCCGGCTTCCTTGAGC
GCGATCTCCAGATCATCTTTTGTGTAGCGAGAAAGCTGACGACGGGGAAGGGCGGCGTGG
TCAGCATGGTGCCGCGCGAGCAGGCGGAGGAggccatcgtggctgacagcaacggcaagg
aggaggaggtcggggtgatgggcgtcagcgccGGGGAGCACGGCGCCGACGACCACCACG
GCGGCGGCGGCAAGTTCAGCATGAAGAACCTGCTCTGGCACGGCGGCTCCGTCTGGGACG
CCTGGTTCAGCTGCGCCTCTAACCAGGTCGCGCAGGTGCTCCTGACGCTGCCGTACTCCT
TCTCGCAGCTCGGGATGCTCTCGGGCGTGCTGCTGCAGCTGTTCTACGGTTTCATGGGCA
GCTGGACCGCCTACCTAATCAGCGTCCTCTACGTCGAGTACCGCTCCCGCAAGGAGAAGG
AAGGCGTCAGCTTCAAGAACCACGTCATCCAGTGGTTCGAGGTGCTGGATGGGCTACTGG
GCCCGTACTGGAAGGCGGCCGGACTCGCCTTCAACTGCACGTTCCTCCTCTTCGGCTCCG
TCATCCAGCTGATCGCCTGCGCGAGTAACATCTACTACATCAACGACCGGCTGGACAAGC
GGACGTGGACGTACATCTTCGGCGCGTGCTGCGCCACCACGGTGTTCATCCCGTCGTTCC
ACAACTACCGGATCTGGTCCTTCCTGGGCCTCGGCATGACCACCTATACCGCTTGGTACC
TCGCCATCGCCGCCCTCCTCAACGGCCAGGCCGAAGGCATCACCCACACCGGTCCAACCA
AGCTGGTGCTGTACTTCACCGGCGCCACCAACATCCTCTACACCTTCGGCGGCCACGCCG
TCACAGTGGAGATCATGCACGCGATGTGGAAACCGGCCAAGTTCAAGTACATCTACCTGC
TGGCGACGCTGTACGTGTTCACGCTGACGCTGCCGTCGGCGTCGGCCATGTACTGGGCGT
TCGGGGACGAGCTGCTGACCCACTCCAACGCCTTCTCGCTGCTGCCCAAGACCGGGTGGC
GCGACGCGGCGGTGATACTGATGCTGATCCACCAGTTCATCACGTTCGGGTTCGCGTGCA
CGCCGCTCTACTTCGTGTGGGAGAAGGTGATCGGCATGCACGACACCAAGAGCATCTGCC
TCAGGGCGCTCGCGCGGCTCCCCATCGTCGTCCCCATCTGGTTCCTCGCCATCATCTTCC
CCTTCTTCGGCCCCATCAACTCCGCCGTCGGCGCGCTCCTCGTCAGCTTCACCGTCTACA
TCATCCCGGCACTCGCCCACATCCTCACCTACCGTACGGCCTCCGCGCGCATGAACGCGG
CGGAGAAGCCACCGTTCTTCCTGCCGAGCTGGACGGGGATGTTCGTGCTCAACATGTTCA
TCGTGGTGTGGGTGCTCGTGGTGGGCTTCGGGCTCGGCGGCTGGGCCAGCATGGTCAACT
TCATCAGGCAGATCGACACGTTCGGGCTCTTCGCCAAGTGCTACCAGTGTCCCAAGCCCG
CCCCGGCGTTGGCGCAGTCGCCGGTGCCATTGCCGCACCACTAGCGCGCGCCCGTTCCGC
ACCACCGCCGCCGCCGCGGCGGACCGTGACAACGTGCACCGCCGAGCCCGGAGCAAGGAA
CCTCGCTCTCCTGGCCGGCACGGCTGCAAAAATTCAGTGTTGCTTAGGTTTTGGTCGCCT
TGTAATATACAAAGCCTCTCCTCCTGTGCTAGGGTGTCACACCAAAATGGTAGAAGAAGA
AGAGGGCATGGGTCCCTACGATCTTGCCCCGGGCCGTCCGCTGCCGCGTTGCTTTCCCCC
GATCCTCGATGGTGTCCTTGTGTTTGTTTGGCTTGCCCCTCCCTCTGGCGATATATATGT
GATGGTCGTCATGGCTTATAAAGATTTTCAGCTCATGTCACATTTTC

CDS

1479 bp

>Os01t0856500-02 Amino acid transporter, transmembrane domain containing protein.
ATGGTGCCGCGCGAGCAGGCGGAGGAggccatcgtggctgacagcaacggcaaggaggag
gaggtcggggtgatgggcgtcagcgccGGGGAGCACGGCGCCGACGACCACCACGGCGGC
GGCGGCAAGTTCAGCATGAAGAACCTGCTCTGGCACGGCGGCTCCGTCTGGGACGCCTGG
TTCAGCTGCGCCTCTAACCAGGTCGCGCAGGTGCTCCTGACGCTGCCGTACTCCTTCTCG
CAGCTCGGGATGCTCTCGGGCGTGCTGCTGCAGCTGTTCTACGGTTTCATGGGCAGCTGG
ACCGCCTACCTAATCAGCGTCCTCTACGTCGAGTACCGCTCCCGCAAGGAGAAGGAAGGC
GTCAGCTTCAAGAACCACGTCATCCAGTGGTTCGAGGTGCTGGATGGGCTACTGGGCCCG
TACTGGAAGGCGGCCGGACTCGCCTTCAACTGCACGTTCCTCCTCTTCGGCTCCGTCATC
CAGCTGATCGCCTGCGCGAGTAACATCTACTACATCAACGACCGGCTGGACAAGCGGACG
TGGACGTACATCTTCGGCGCGTGCTGCGCCACCACGGTGTTCATCCCGTCGTTCCACAAC
TACCGGATCTGGTCCTTCCTGGGCCTCGGCATGACCACCTATACCGCTTGGTACCTCGCC
ATCGCCGCCCTCCTCAACGGCCAGGCCGAAGGCATCACCCACACCGGTCCAACCAAGCTG
GTGCTGTACTTCACCGGCGCCACCAACATCCTCTACACCTTCGGCGGCCACGCCGTCACA
GTGGAGATCATGCACGCGATGTGGAAACCGGCCAAGTTCAAGTACATCTACCTGCTGGCG
ACGCTGTACGTGTTCACGCTGACGCTGCCGTCGGCGTCGGCCATGTACTGGGCGTTCGGG
GACGAGCTGCTGACCCACTCCAACGCCTTCTCGCTGCTGCCCAAGACCGGGTGGCGCGAC
GCGGCGGTGATACTGATGCTGATCCACCAGTTCATCACGTTCGGGTTCGCGTGCACGCCG
CTCTACTTCGTGTGGGAGAAGGTGATCGGCATGCACGACACCAAGAGCATCTGCCTCAGG
GCGCTCGCGCGGCTCCCCATCGTCGTCCCCATCTGGTTCCTCGCCATCATCTTCCCCTTC
TTCGGCCCCATCAACTCCGCCGTCGGCGCGCTCCTCGTCAGCTTCACCGTCTACATCATC
CCGGCACTCGCCCACATCCTCACCTACCGTACGGCCTCCGCGCGCATGAACGCGGCGGAG
AAGCCACCGTTCTTCCTGCCGAGCTGGACGGGGATGTTCGTGCTCAACATGTTCATCGTG
GTGTGGGTGCTCGTGGTGGGCTTCGGGCTCGGCGGCTGGGCCAGCATGGTCAACTTCATC
AGGCAGATCGACACGTTCGGGCTCTTCGCCAAGTGCTACCAGTGTCCCAAGCCCGCCCCG
GCGTTGGCGCAGTCGCCGGTGCCATTGCCGCACCACTAG

Protein

493 aa

>Os01t0856500-02 Amino acid transporter, transmembrane domain containing protein.
MVPREQAEEAIVADSNGKEEEVGVMGVSAGEHGADDHHGGGGKFSMKNLLWHGGSVWDAW
FSCASNQVAQVLLTLPYSFSQLGMLSGVLLQLFYGFMGSWTAYLISVLYVEYRSRKEKEG
VSFKNHVIQWFEVLDGLLGPYWKAAGLAFNCTFLLFGSVIQLIACASNIYYINDRLDKRT
WTYIFGACCATTVFIPSFHNYRIWSFLGLGMTTYTAWYLAIAALLNGQAEGITHTGPTKL
VLYFTGATNILYTFGGHAVTVEIMHAMWKPAKFKYIYLLATLYVFTLTLPSASAMYWAFG
DELLTHSNAFSLLPKTGWRDAAVILMLIHQFITFGFACTPLYFVWEKVIGMHDTKSICLR
ALARLPIVVPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPALAHILTYRTASARMNAAE
KPPFFLPSWTGMFVLNMFIVVWVLVVGFGLGGWASMVNFIRQIDTFGLFAKCYQCPKPAP
ALAQSPVPLPHH*

5'UTR

chr01:36998743..36998837 (+ strand) : 95 bp

chr01:36998987..36999016 (+ strand) : 30 bp

CDS

chr01:36999017..36999217 (+ strand) : 201 bp

chr01:36999350..36999535 (+ strand) : 186 bp

chr01:36999956..37000068 (+ strand) : 113 bp

chr01:37000245..37000428 (+ strand) : 184 bp

chr01:37000540..37000637 (+ strand) : 98 bp

chr01:37002304..37002769 (+ strand) : 466 bp

chr01:37003886..37004116 (+ strand) : 231 bp

3'UTR

chr01:37004117..37004479 (+ strand) : 363 bp

FASTA

>Os01t0856500-02 class=Sequence position=chr01:36998743..37004479 (+ strand)
ACTCTCCACC GGCACCCTGC ATTTACTGCT CCCCCATCAC TCGCCCCGGC TTCCTTGAGC GCGATCTCCA GATCATCTTT
TGTGTAGCGA GAAAGGTTGG TGCTCTTCTT CTTCTTCTTC TTGCTGCTGC AGCTGGTGGT GTTGTTTTTT TTATTGGCGG
GGTCGGTTTC CTGCTCTGTT TTGTTAAGTC ATATTGTGCT GTCCTGGATC TTGATCCGAC GTCCGTCCGT ACGCACTCAC
GCAGCTGACG ACGGGGAAGG GCGGCGTGGT CAGCATGGTG CCGCGCGAGC AGGCGGAGGA ggccatcgtg gctgacagca
acggcaagga ggaggaggtc ggggtgatgg gcgtcagcgc cGGGGAGCAC GGCGCCGACG ACCACCACGG CGGCGGCGGC
AAGTTCAGCA TGAAGAACCT GCTCTGGCAC GGCGGCTCCG TCTGGGACGC CTGGTTCAGC TGCGCCTCTA ACCAGGTATA
ACTCATCCTG CTCCGCCATG GCCGCCATCG CGGCCATGCA GCTCGCTCGA TGAAGGAATC ATATCGAGAC GAATCCGAAA
GGCAGCGTGA CTGAATTTCT GAATTTCCTG GTGGTGGGTT TCTGCAGGTC GCGCAGGTGC TCCTGACGCT GCCGTACTCC
TTCTCGCAGC TCGGGATGCT CTCGGGCGTG CTGCTGCAGC TGTTCTACGG TTTCATGGGC AGCTGGACCG CCTACCTAAT
CAGCGTCCTC TACGTCGAGT ACCGCTCCCG CAAGGAGAAG GAAGGCGTCA GCTTCAAGAA CCACGTCATC CAGGTACCCG
CCCCGCCTTG TCATGCCATG GCCGTGCTGG CCTTGTCGCT TCTTCGTATC CTCCTCCTCA TCAGTAACGG ATTGTTACAG
CTTCTTATCC CCGTCTTTAT GTGGCATAAT CGAAAACACA TTTTTCTCGA GCACGCATTT TTTCCCCTTC CGTTTGGTCG
TTTTCGATCC TTACTGGCTT GAAAAATGCC TCCTTTTCTT TTGTGAAAAT GGCAGGGGGT ATTGGATCCC CTGCCTCCCA
TGGCTCTCTT CTGGTTGCTT GCCGAAATGA AAGCCGAGCC TGAATCGAGC TCATCCTTAA TCCTTGTTCA ATTAATCACT
TATTACTGCA AATTTTGCAT AACTACACAA CTATAGTTAC TATACTAACA ACTGGGGCTA ATGGGAGAAG CTTGTGACGT
TGACTGGTGG CAGTGGTTCG AGGTGCTGGA TGGGCTACTG GGCCCGTACT GGAAGGCGGC CGGACTCGCC TTCAACTGCA
CGTTCCTCCT CTTCGGCTCC GTCATCCAGC TGATCGCCTG CGCGAGGTCA AATTCCTTTC CTCCCCAACT CAACCAACCA
ACCATCACTC TCCCACTGTC ACTTCGCAGC GCCAGTGTAA ATATGTAGCC GTGCTGCTGC GCAACAGTGT GTCGTGGTGA
CAGATTGGGT TTGTGCGGAT GGGCTGAAAA CCTGACCGAT AATTTGGTGG TGTTTTCTTC AGTAACATCT ACTACATCAA
CGACCGGCTG GACAAGCGGA CGTGGACGTA CATCTTCGGC GCGTGCTGCG CCACCACGGT GTTCATCCCG TCGTTCCACA
ACTACCGGAT CTGGTCCTTC CTGGGCCTCG GCATGACCAC CTATACCGCT TGGTACCTCG CCATCGCCGC CCTCCTCAAC
GGCCAGGTGA GATAAGAAGA GGGAAACTGT CCTTGTCACT TTCTCGATCA TCCATCGCGT CTACTACATG TCCATTTAGC
TTGGGTTTGC AGTGACTGAT GATCGTTTGC GTCGCAGGCC GAAGGCATCA CCCACACCGG TCCAACCAAG CTGGTGCTGT
ACTTCACCGG CGCCACCAAC ATCCTCTACA CCTTCGGCGG CCACGCCGTC ACAGTGTAAG CAAAGCAGAA CTTGCTCTGT
TTGTCCAGTT GTTAATACTG TACAGTAGTA TTAGTACTAG GACTACAAGC TAATCCTCCT GAGGAAGTGA AGTGAGGGAG
AACTTTTCAC TAGCTGCAGC TTTTGCCTGC CAATGTGGAG GACATGTCCC GATTGGAAAT CAGGTTCTGG TTTCCATTCC
ATTGGTCCCC CTCCATGGTA CTGGTACTCG CACCTCACTG GTCACAGTGT AGTATAGTGA GTACTACTAC TACTACTAAG
CTTAATTAAA ACACACGTAG CTGTAGCTTT GCAGCTAGTT AGCTCTATGG CGTACAGATC CCAATGGATG GATAGGGGCA
CTTAAAAATT CCAAGCCTGT GCGCGGTGGG AAACAGCTGC GTTAGCTTGC GACCATTAGT CGGCTGATCG ATTGATATCG
GTCGATAAAA ATTTATAAAG ATCGATCCAG CTGCTAAAGC TCGGTGCGTT CATGTGCATG TGCGATGTGC TGAACTGGTG
ATGCATCCAA AAGGTCCCCT GCTAGTACAC GCGATGGTTT AGGGGAGAAA AGAATGGGCC ACTATGCATT AGAATAGACT
CCTTGAGCCC CTTTATTCCC ATTGCTCGTT TATGTGCCTA ATCTATTGCT TGGATTATTG AGTGTGTTTT TGCTTTGGCA
TGATTAGAGG CCCATGCGAG GAATAATTAG CGTTTCAGTG CGCTGTTCCT TCAAAATGCG ATGGTCGTTA GTGCCTTAGT
GGTCGCATGC AGTTCGGATT GGAGATTTGA TGATCTTATA GTAGTATATA TAGTATCTCC TAGCTTCAAA AATTTAATGT
AGTGCTACCA GTACTTGTTC CATAGTTGTG AAAATTGAAA ATGCTTTTGA TGGGTTGGAA ATGGAATGGA ATGATAAGGG
GGGCCAGCTT CATTCAATTC AGCTAGTGCG GAGTTCACAT CAAGCTATGC AATTCCGTGC TAGTTGCCCT AATCCAACGG
GGTGAAATGA TTTCCATCAT GGATTGGGAC ATCTTGGTGC CAAATCATCC AATGATGATT CCATTTATAT CTTACTACTA
CTATTATGCT GCTAGGCTTG CATGGGAAAG TTTAGCTTAG TGGGGCGAAG GGGACACAGA CCTGCTTTGA GAATTGCTTC
CCAATTGAAG AATGTGAGTG TCTTTGTCCA TCTTGACAAT GCCCCTCACC ACTTCTGGTC TCAGGCTAAT TCAAAGCCCA
GTTTGGTAGC GACATGAGAC CATTAGCATA ACATGCATGG GATGGGATCT TCGCTAGCTG TGGAGCAGAG TTTTTAGGTG
ATTAGTACTC GTATTTAGTG GTATAAATTA TTATTGGCAA CGGCCTTATT TGGCCGTATT TGTCGGCTCC TCCATCATTT
GACCGGTGGC GGATACATGT GTTGGTGAAA GAAAGAAAGC AATTGCGAGA TTCCCCCTGC CGCCGCGATC CTTGCATGTA
TCCTGCCTGC GTGACTAGGA GAAGCAGCAG CTGTAGTAGT AGTCCTACTT TTTGGCCGTA TCATTTGATC AAGCTGATTA
AAGTCTCAGC ATCATTGACT CGCATGTGCC GAGGCCGTTT TGTCCGTTGA TTTGTTGATT AATAACCTGC AAGAAAAGAA
AATAATGACT GATTGGGGGT GGCTGTTTTG GATTGGTGCA GGGAGATCAT GCACGCGATG TGGAAACCGG CCAAGTTCAA
GTACATCTAC CTGCTGGCGA CGCTGTACGT GTTCACGCTG ACGCTGCCGT CGGCGTCGGC CATGTACTGG GCGTTCGGGG
ACGAGCTGCT GACCCACTCC AACGCCTTCT CGCTGCTGCC CAAGACCGGG TGGCGCGACG CGGCGGTGAT ACTGATGCTG
ATCCACCAGT TCATCACGTT CGGGTTCGCG TGCACGCCGC TCTACTTCGT GTGGGAGAAG GTGATCGGCA TGCACGACAC
CAAGAGCATC TGCCTCAGGG CGCTCGCGCG GCTCCCCATC GTCGTCCCCA TCTGGTTCCT CGCCATCATC TTCCCCTTCT
TCGGCCCCAT CAACTCCGCC GTCGGCGCGC TCCTCGTCAG CTTCACCGTC TACATCATCC CGGCACTCGC CCACATCCTC
ACCTACCGTA CGGCCTCCGC GCGCATGGTA ACCTCAAGAA CCTCTCTGCA CATGCCCTAA CTATGCCCCA TCATCATCGC
TGCATGCATG TTTTTGTTCC GGTACACCGC CTCGTCCATC CATCCACGCA TTCAATGGCA GGTACTAGTG CAAGCTAGGG
CGAATGCAAC GTGACGGCCA ACTTATACTA ACAACTGGGT CCGATGGATT TCATCGACGC TTCCTCCGTG TTGCTATAGC
TGAGCAGCGG ATCGGTCGAG CCATCATCAA CAGTGGCGAG ACTGGAACAC ACAGGCAATA GAATAGACAG TGGAGATCTG
TGCGCAGGCA GCAGAAGCAA GCAGCAGTTC GTGTTGAATG CAAAAGCACA GCCGGGCCGT GCCCGGGGCC CACCTCATAC
ATGGGCAAAT CCCCAATCAT TGAATCCAGC CAACAACCAC ATTAATTCCA AGCAGCGCCC CCCCCCCCCC CCCCCTCCCC
TCTCGATTCT GGCCGCTGCT TTGGCAGTAT CTTCCCCAAG AGAGGTTAGC TTAGCCTAGT CACTTTGGTT TAGTGACCGT
GCCCAGTTCT GGTGCGCTAC TGCTCCCATG TATAGTGTCT CAGATTAGGA GCCCAACCAA AGGTGGTCCC TGCTTATCTG
GCTGGCTGCT GCCGCGCGGC TCGGTACAGC GGACGAATCC ACCCGTAGAC TCTCTGTGCA CCGTGCGCGA CGACGCGAAG
AAACGCGCGG AAAGCAACGG TTGACGCCGC GGTGGATGAG GTGGGACGGA CGCGCTGCTG ATGTTTTCGC GCCGGCGCTG
CTATCGCGGG TGGGACATAT GTAAGACTTC CGCTTGGCGC GTAGCCGGAG GCGATGGCGC GGTGGTCGCC GTCGCGCCCG
TCAGGTCAGG GGGCGCGCGC GGCTAGCTTA GCTTTTTTCG CGCGTGGGGG GAGGGGTTTG GGAGATTTTT GTGCGTGGGT
AGCCTTTCCC TCTCGATCCC CTTCCTTTTT CCGCGCCTTT CCGAAAGGCG ATCGACCGAA CGTGCGTGGT AGTACGGACG
CGGCACGGCG AATAAAACCA GCAAGCACCA ACCATGTTTT ATGTTGAGAA TCTACAATAC GCATCTCTTT TTTGACGAGG
GTTTATGTTG TTGTTTGCAA CAGAACGCGG CGGAGAAGCC ACCGTTCTTC CTGCCGAGCT GGACGGGGAT GTTCGTGCTC
AACATGTTCA TCGTGGTGTG GGTGCTCGTG GTGGGCTTCG GGCTCGGCGG CTGGGCCAGC ATGGTCAACT TCATCAGGCA
GATCGACACG TTCGGGCTCT TCGCCAAGTG CTACCAGTGT CCCAAGCCCG CCCCGGCGTT GGCGCAGTCG CCGGTGCCAT
TGCCGCACCA CTAGCGCGCG CCCGTTCCGC ACCACCGCCG CCGCCGCGGC GGACCGTGAC AACGTGCACC GCCGAGCCCG
GAGCAAGGAA CCTCGCTCTC CTGGCCGGCA CGGCTGCAAA AATTCAGTGT TGCTTAGGTT TTGGTCGCCT TGTAATATAC
AAAGCCTCTC CTCCTGTGCT AGGGTGTCAC ACCAAAATGG TAGAAGAAGA AGAGGGCATG GGTCCCTACG ATCTTGCCCC
GGGCCGTCCG CTGCCGCGTT GCTTTCCCCC GATCCTCGAT GGTGTCCTTG TGTTTGTTTG GCTTGCCCCT CCCTCTGGCG
ATATATATGT GATGGTCGTC ATGGCTTATA AAGATTTTCA GCTCATGTCA CATTTTC

Locus: Os01g0856500

Loading...

Locus: Os01g0856500

Loading...