Os01t0856500-03

Locus

Os01g0856500

Description

Splicing variant with unknown function

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsLAX1, OsRAU1, OsAUX1, LAX1, RAU1, AUX1

Oryzabase Gene Name Synonym(s)

like aux1-1, related to AUX1-1, auxin transporter 1

Transcript Evidence

AK068536

Protein Evidence

Q5N892-2

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

September 2, 2015

Functional domain (InterPro)

Amino acid transporter, transmembrane domain (IPR013057)

Full-length cDNA

J013152G03 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0856500-03)

RiceXPro (AK068536)

Others

Oryzabase (11916)

KEGG (Os01t0856500-03)

Transcript

1541 bp

>Os01t0856500-03 Splicing variant with unknown function
ATCCAGCTGATCGCCTGCGCGAGGTCAAATTCCTTTCCTCCCCAACTCAACCAACCAACC
ATCACTCTCCCACTGTCACTTCGCAGCGCCAGTGTAAATATGTAGCCGTGCTGCTGCGCA
ACAGTGTGTCGTGGTGACAGATTGGGTTTGTGCGGATGGGCTGAAAACCTGACCGATAAT
TTGGTGGTGTTTTCTTCAGTAACATCTACTACATCAACGACCGGCTGGACAAGCGGACGT
GGACGTACATCTTCGGCGCGTGCTGCGCCACCACGGTGTTCATCCCGTCGTTCCACAACT
ACCGGATCTGGTCCTTCCTGGGCCTCGGCATGACCACCTATACCGCTTGGTACCTCGCCA
TCGCCGCCCTCCTCAACGGCCAGGCCGAAGGCATCACCCACACCGGTCCAACCAAGCTGG
TGCTGTACTTCACCGGCGCCACCAACATCCTCTACACCTTCGGCGGCCACGCCGTCACAG
TGGAGATCATGCACGCGATGTGGAAACCGGCCAAGTTCAAGTACATCTACCTGCTGGCGA
CGCTGTACGTGTTCACGCTGACGCTGCCGTCGGCGTCGGCCATGTACTGGGCGTTCGGGG
ACGAGCTGCTGACCCACTCCAACGCCTTCTCGCTGCTGCCCAAGACCGGGTGGCGCGACG
CGGCGGTGATACTGATGCTGATCCACCAGTTCATCACGTTCGGGTTCGCGTGCACGCCGC
TCTACTTCGTGTGGGAGAAGGTGATCGGCATGCACGACACCAAGAGCATCTGCCTCAGGG
CGCTCGCGCGGCTCCCCATCGTCGTCCCCATCTGGTTCCTCGCCATCATCTTCCCCTTCT
TCGGCCCCATCAACTCCGCCGTCGGCGCGCTCCTCGTCAGCTTCACCGTCTACATCATCC
CGGCACTCGCCCACATCCTCACCTACCGTACGGCCTCCGCGCGCATGAACGCGGCGGAGA
AGCCACCGTTCTTCCTGCCGAGCTGGACGGGGATGTTCGTGCTCAACATGTTCATCGTGG
TGTGGGTGCTCGTGGTGGGCTTCGGGCTCGGCGGCTGGGCCAGCATGGTCAACTTCATCA
GGCAGATCGACACGTTCGGGCTCTTCGCCAAGTGCTACCAGTGTCCCAAGCCCGCCCCGG
CGTTGGCGCAGTCGCCGGTGCCATTGCCGCACCACTAGCGCGCGCCCGTTCCGCACCACC
GCCGCCGCCGCGGCGGACCGTGACAACGTGCACCGCCGAGCCCGGAGCAAGGAACCTCGC
TCTCCTGGCCGGCACGGCTGCAAAAATTCAGTGTTGCTTAGGTTTTGGTCGCCTTGTAAT
ATACAAAGCCTCTCCTCCTGTGCTAGGGTGTCACACCAAAATGGTAGAAGAAGAAGAGGG
CATGGGTCCCTACGATCTTGCCCCGGGCCGTCCGCTGCCGCGTTGCTTTCCCCCGATCCT
CGATGGTGTCCTTGTGTTTGTTTGGCTTGCCCCTCCCTCTGGCGATATATATGTGATGGT
CGTCATGGCTTATAAAGATTTTCAGCTCATGTCACATTTTC

CDS

849 bp

>Os01t0856500-03 Splicing variant with unknown function
ATGACCACCTATACCGCTTGGTACCTCGCCATCGCCGCCCTCCTCAACGGCCAGGCCGAA
GGCATCACCCACACCGGTCCAACCAAGCTGGTGCTGTACTTCACCGGCGCCACCAACATC
CTCTACACCTTCGGCGGCCACGCCGTCACAGTGGAGATCATGCACGCGATGTGGAAACCG
GCCAAGTTCAAGTACATCTACCTGCTGGCGACGCTGTACGTGTTCACGCTGACGCTGCCG
TCGGCGTCGGCCATGTACTGGGCGTTCGGGGACGAGCTGCTGACCCACTCCAACGCCTTC
TCGCTGCTGCCCAAGACCGGGTGGCGCGACGCGGCGGTGATACTGATGCTGATCCACCAG
TTCATCACGTTCGGGTTCGCGTGCACGCCGCTCTACTTCGTGTGGGAGAAGGTGATCGGC
ATGCACGACACCAAGAGCATCTGCCTCAGGGCGCTCGCGCGGCTCCCCATCGTCGTCCCC
ATCTGGTTCCTCGCCATCATCTTCCCCTTCTTCGGCCCCATCAACTCCGCCGTCGGCGCG
CTCCTCGTCAGCTTCACCGTCTACATCATCCCGGCACTCGCCCACATCCTCACCTACCGT
ACGGCCTCCGCGCGCATGAACGCGGCGGAGAAGCCACCGTTCTTCCTGCCGAGCTGGACG
GGGATGTTCGTGCTCAACATGTTCATCGTGGTGTGGGTGCTCGTGGTGGGCTTCGGGCTC
GGCGGCTGGGCCAGCATGGTCAACTTCATCAGGCAGATCGACACGTTCGGGCTCTTCGCC
AAGTGCTACCAGTGTCCCAAGCCCGCCCCGGCGTTGGCGCAGTCGCCGGTGCCATTGCCG
CACCACTAG

Protein

283 aa

>Os01t0856500-03 Splicing variant with unknown function
MTTYTAWYLAIAALLNGQAEGITHTGPTKLVLYFTGATNILYTFGGHAVTVEIMHAMWKP
AKFKYIYLLATLYVFTLTLPSASAMYWAFGDELLTHSNAFSLLPKTGWRDAAVILMLIHQ
FITFGFACTPLYFVWEKVIGMHDTKSICLRALARLPIVVPIWFLAIIFPFFGPINSAVGA
LLVSFTVYIIPALAHILTYRTASARMNAAEKPPFFLPSWTGMFVLNMFIVVWVLVVGFGL
GGWASMVNFIRQIDTFGLFAKCYQCPKPAPALAQSPVPLPHH*

5'UTR

chr01:37000046..37000374 (+ strand) : 329 bp

CDS

chr01:37000375..37000428 (+ strand) : 54 bp

chr01:37000540..37000637 (+ strand) : 98 bp

chr01:37002304..37002769 (+ strand) : 466 bp

chr01:37003886..37004116 (+ strand) : 231 bp

3'UTR

chr01:37004117..37004479 (+ strand) : 363 bp

FASTA

>Os01t0856500-03 class=Sequence position=chr01:37000046..37004479 (+ strand)
ATCCAGCTGA TCGCCTGCGC GAGGTCAAAT TCCTTTCCTC CCCAACTCAA CCAACCAACC ATCACTCTCC CACTGTCACT
TCGCAGCGCC AGTGTAAATA TGTAGCCGTG CTGCTGCGCA ACAGTGTGTC GTGGTGACAG ATTGGGTTTG TGCGGATGGG
CTGAAAACCT GACCGATAAT TTGGTGGTGT TTTCTTCAGT AACATCTACT ACATCAACGA CCGGCTGGAC AAGCGGACGT
GGACGTACAT CTTCGGCGCG TGCTGCGCCA CCACGGTGTT CATCCCGTCG TTCCACAACT ACCGGATCTG GTCCTTCCTG
GGCCTCGGCA TGACCACCTA TACCGCTTGG TACCTCGCCA TCGCCGCCCT CCTCAACGGC CAGGTGAGAT AAGAAGAGGG
AAACTGTCCT TGTCACTTTC TCGATCATCC ATCGCGTCTA CTACATGTCC ATTTAGCTTG GGTTTGCAGT GACTGATGAT
CGTTTGCGTC GCAGGCCGAA GGCATCACCC ACACCGGTCC AACCAAGCTG GTGCTGTACT TCACCGGCGC CACCAACATC
CTCTACACCT TCGGCGGCCA CGCCGTCACA GTGTAAGCAA AGCAGAACTT GCTCTGTTTG TCCAGTTGTT AATACTGTAC
AGTAGTATTA GTACTAGGAC TACAAGCTAA TCCTCCTGAG GAAGTGAAGT GAGGGAGAAC TTTTCACTAG CTGCAGCTTT
TGCCTGCCAA TGTGGAGGAC ATGTCCCGAT TGGAAATCAG GTTCTGGTTT CCATTCCATT GGTCCCCCTC CATGGTACTG
GTACTCGCAC CTCACTGGTC ACAGTGTAGT ATAGTGAGTA CTACTACTAC TACTAAGCTT AATTAAAACA CACGTAGCTG
TAGCTTTGCA GCTAGTTAGC TCTATGGCGT ACAGATCCCA ATGGATGGAT AGGGGCACTT AAAAATTCCA AGCCTGTGCG
CGGTGGGAAA CAGCTGCGTT AGCTTGCGAC CATTAGTCGG CTGATCGATT GATATCGGTC GATAAAAATT TATAAAGATC
GATCCAGCTG CTAAAGCTCG GTGCGTTCAT GTGCATGTGC GATGTGCTGA ACTGGTGATG CATCCAAAAG GTCCCCTGCT
AGTACACGCG ATGGTTTAGG GGAGAAAAGA ATGGGCCACT ATGCATTAGA ATAGACTCCT TGAGCCCCTT TATTCCCATT
GCTCGTTTAT GTGCCTAATC TATTGCTTGG ATTATTGAGT GTGTTTTTGC TTTGGCATGA TTAGAGGCCC ATGCGAGGAA
TAATTAGCGT TTCAGTGCGC TGTTCCTTCA AAATGCGATG GTCGTTAGTG CCTTAGTGGT CGCATGCAGT TCGGATTGGA
GATTTGATGA TCTTATAGTA GTATATATAG TATCTCCTAG CTTCAAAAAT TTAATGTAGT GCTACCAGTA CTTGTTCCAT
AGTTGTGAAA ATTGAAAATG CTTTTGATGG GTTGGAAATG GAATGGAATG ATAAGGGGGG CCAGCTTCAT TCAATTCAGC
TAGTGCGGAG TTCACATCAA GCTATGCAAT TCCGTGCTAG TTGCCCTAAT CCAACGGGGT GAAATGATTT CCATCATGGA
TTGGGACATC TTGGTGCCAA ATCATCCAAT GATGATTCCA TTTATATCTT ACTACTACTA TTATGCTGCT AGGCTTGCAT
GGGAAAGTTT AGCTTAGTGG GGCGAAGGGG ACACAGACCT GCTTTGAGAA TTGCTTCCCA ATTGAAGAAT GTGAGTGTCT
TTGTCCATCT TGACAATGCC CCTCACCACT TCTGGTCTCA GGCTAATTCA AAGCCCAGTT TGGTAGCGAC ATGAGACCAT
TAGCATAACA TGCATGGGAT GGGATCTTCG CTAGCTGTGG AGCAGAGTTT TTAGGTGATT AGTACTCGTA TTTAGTGGTA
TAAATTATTA TTGGCAACGG CCTTATTTGG CCGTATTTGT CGGCTCCTCC ATCATTTGAC CGGTGGCGGA TACATGTGTT
GGTGAAAGAA AGAAAGCAAT TGCGAGATTC CCCCTGCCGC CGCGATCCTT GCATGTATCC TGCCTGCGTG ACTAGGAGAA
GCAGCAGCTG TAGTAGTAGT CCTACTTTTT GGCCGTATCA TTTGATCAAG CTGATTAAAG TCTCAGCATC ATTGACTCGC
ATGTGCCGAG GCCGTTTTGT CCGTTGATTT GTTGATTAAT AACCTGCAAG AAAAGAAAAT AATGACTGAT TGGGGGTGGC
TGTTTTGGAT TGGTGCAGGG AGATCATGCA CGCGATGTGG AAACCGGCCA AGTTCAAGTA CATCTACCTG CTGGCGACGC
TGTACGTGTT CACGCTGACG CTGCCGTCGG CGTCGGCCAT GTACTGGGCG TTCGGGGACG AGCTGCTGAC CCACTCCAAC
GCCTTCTCGC TGCTGCCCAA GACCGGGTGG CGCGACGCGG CGGTGATACT GATGCTGATC CACCAGTTCA TCACGTTCGG
GTTCGCGTGC ACGCCGCTCT ACTTCGTGTG GGAGAAGGTG ATCGGCATGC ACGACACCAA GAGCATCTGC CTCAGGGCGC
TCGCGCGGCT CCCCATCGTC GTCCCCATCT GGTTCCTCGC CATCATCTTC CCCTTCTTCG GCCCCATCAA CTCCGCCGTC
GGCGCGCTCC TCGTCAGCTT CACCGTCTAC ATCATCCCGG CACTCGCCCA CATCCTCACC TACCGTACGG CCTCCGCGCG
CATGGTAACC TCAAGAACCT CTCTGCACAT GCCCTAACTA TGCCCCATCA TCATCGCTGC ATGCATGTTT TTGTTCCGGT
ACACCGCCTC GTCCATCCAT CCACGCATTC AATGGCAGGT ACTAGTGCAA GCTAGGGCGA ATGCAACGTG ACGGCCAACT
TATACTAACA ACTGGGTCCG ATGGATTTCA TCGACGCTTC CTCCGTGTTG CTATAGCTGA GCAGCGGATC GGTCGAGCCA
TCATCAACAG TGGCGAGACT GGAACACACA GGCAATAGAA TAGACAGTGG AGATCTGTGC GCAGGCAGCA GAAGCAAGCA
GCAGTTCGTG TTGAATGCAA AAGCACAGCC GGGCCGTGCC CGGGGCCCAC CTCATACATG GGCAAATCCC CAATCATTGA
ATCCAGCCAA CAACCACATT AATTCCAAGC AGCGCCCCCC CCCCCCCCCC CCTCCCCTCT CGATTCTGGC CGCTGCTTTG
GCAGTATCTT CCCCAAGAGA GGTTAGCTTA GCCTAGTCAC TTTGGTTTAG TGACCGTGCC CAGTTCTGGT GCGCTACTGC
TCCCATGTAT AGTGTCTCAG ATTAGGAGCC CAACCAAAGG TGGTCCCTGC TTATCTGGCT GGCTGCTGCC GCGCGGCTCG
GTACAGCGGA CGAATCCACC CGTAGACTCT CTGTGCACCG TGCGCGACGA CGCGAAGAAA CGCGCGGAAA GCAACGGTTG
ACGCCGCGGT GGATGAGGTG GGACGGACGC GCTGCTGATG TTTTCGCGCC GGCGCTGCTA TCGCGGGTGG GACATATGTA
AGACTTCCGC TTGGCGCGTA GCCGGAGGCG ATGGCGCGGT GGTCGCCGTC GCGCCCGTCA GGTCAGGGGG CGCGCGCGGC
TAGCTTAGCT TTTTTCGCGC GTGGGGGGAG GGGTTTGGGA GATTTTTGTG CGTGGGTAGC CTTTCCCTCT CGATCCCCTT
CCTTTTTCCG CGCCTTTCCG AAAGGCGATC GACCGAACGT GCGTGGTAGT ACGGACGCGG CACGGCGAAT AAAACCAGCA
AGCACCAACC ATGTTTTATG TTGAGAATCT ACAATACGCA TCTCTTTTTT GACGAGGGTT TATGTTGTTG TTTGCAACAG
AACGCGGCGG AGAAGCCACC GTTCTTCCTG CCGAGCTGGA CGGGGATGTT CGTGCTCAAC ATGTTCATCG TGGTGTGGGT
GCTCGTGGTG GGCTTCGGGC TCGGCGGCTG GGCCAGCATG GTCAACTTCA TCAGGCAGAT CGACACGTTC GGGCTCTTCG
CCAAGTGCTA CCAGTGTCCC AAGCCCGCCC CGGCGTTGGC GCAGTCGCCG GTGCCATTGC CGCACCACTA GCGCGCGCCC
GTTCCGCACC ACCGCCGCCG CCGCGGCGGA CCGTGACAAC GTGCACCGCC GAGCCCGGAG CAAGGAACCT CGCTCTCCTG
GCCGGCACGG CTGCAAAAAT TCAGTGTTGC TTAGGTTTTG GTCGCCTTGT AATATACAAA GCCTCTCCTC CTGTGCTAGG
GTGTCACACC AAAATGGTAG AAGAAGAAGA GGGCATGGGT CCCTACGATC TTGCCCCGGG CCGTCCGCTG CCGCGTTGCT
TTCCCCCGAT CCTCGATGGT GTCCTTGTGT TTGTTTGGCT TGCCCCTCCC TCTGGCGATA TATATGTGAT GGTCGTCATG
GCTTATAAAG ATTTTCAGCT CATGTCACAT TTTC

Locus: Os01g0856500

Loading...

Locus: Os01g0856500

Loading...