Os01t0856500-04

Locus

Os01g0856500

Description

Similar to auxin transporter-like protein 1.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsLAX1, OsRAU1, OsAUX1, LAX1, RAU1, AUX1

Oryzabase Gene Name Synonym(s)

like aux1-1, related to AUX1-1, auxin transporter 1

Transcript Evidence

AK103981 (DDBJ, Best hit)

Protein Evidence

NP_001151566.1 (RefSeq)

Literature

Note

Manual Curation

Functional domain (InterPro)

Amino acid transporter, transmembrane (IPR013057)

Full-length cDNA

001-017-C03 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0856500-04)

RiceXPro (AK103981)

Others

Oryzabase (11916)

KEGG (Os01t0856500-04)

Transcript

1494 bp

>Os01t0856500-04 Similar to auxin transporter-like protein 1.
CATCAACGACCGGCTGGACAAGCGGACGTGGACGTACATCTTCGGCGCGTGCTGCGCCAC
CACGGTGTTCATCCCGTCGTTCCACAACTACCGGATCTGGTCCTTCCTGGGCCTCGGCAT
GACCACCTATACCGCTTGGTACCTCGCCATCGCCGCCCTCCTCAACGGCCAGGCCGAAGG
CATCACCCACACCGGTCCAACCAAGCTGGTGCTGTACTTCACCGGCGCCACCAACATCCT
CTACACCTTCGGCGGCCACGCCGTCACAGTGGAGATCATGCACGCGATGTGGAAACCGGC
CAAGTTCAAGTACATCTACCTGCTGGCGACGCTGTACGTGTTCACGCTGACGCTGCCGTC
GGCGTCGGCCATGTACTGGGCGTTCGGGGACGAGCTGCTGACCCACTCCAACGCCTTCTC
GCTGCTGCCCAAGACCGGGTGGCGCGACGCGGCGGTGATACTGATGCTGATCCACCAGTT
CATCACGTTCGGGTTCGCGTGCACGCCGCTCTACTTCGTGTGGGAGAAGGTGATCGGCAT
GCACGACACCAAGAGCATCTGCCTCAGGGCGCTCGCGCGGCTCCCCATCGTCGTCCCCAT
CTGGTTCCTCGCCATCATCTTCCCCTTCTTCGGCCCCATCAACTCCGCCGTCGGCGCGCT
CCTCGTCAGCTTCACCGTCTACATCATCCCGGCACTCGCCCACATCCTCACCTACCGTAC
GGCCTCCGCGCGCATGAACGCGGCGGAGAAGCCACCGTTCTTCCTGCCGAGCTGGACGGG
GATGTTCGTGCTCAACATGTTCATCGTGGTGTGGGTGCTCGTGGTGGGCTTCGGGCTCGG
CGGCTGGGCCAGCATGGTCAACTTCATCAGGCAGATCGACACGTTCGGGCTCTTCGCCAA
GTGCTACCAGTGTCCCAAGCCCGCCCCGGCGTTGGCGCAGTCGCCGGTGCCATTGCCGCA
CCACTAGCGCGCGCCCGTTCCGCACCACCGCCGCCGCCGCGGCGGACCGTGACAACGTGC
ACCGCCGAGCCCGGAGCAAGGAACCTCGCTCTCCTGGCCGGCACGGCTGCAAAAATTCAG
TGTTGCTTAGGTTTTGGTCGCCTTGTAATATACAAAGCCTCTCCTCCTGTGCTAGGGTGT
CACACCAAAATGGTAGAAGAAGAAGAGGGCATGGGTCCCTACGATCTTGCCCCGGGCCGT
CCGCTGCCGCGTTGCTTTCCCCCGATCCTCGATGGTGTCCTTGTGTTTGTTTGGCTTGCC
CCTCCCTCTGGCGATATATATGTGATGGTCGTCATGGCTTATAAAGATTTTCAGCTCATG
TCACATTTTCATATGATATGATGTAGCATATCACTATAGGGTTATTTGTTTTCTACCTGG
ATGGAGCTTGGTCCATGTTGTCTAGCGCGAGCAATTGTAATCGGCGATTCCTCGTGCTAG
CTAAAGGCAAAACACGGAGGCCTTTGTTTATTGCGTTCCGCTTTGGATGTTCTT

CDS

966 bp

>Os01t0856500-04 Similar to auxin transporter-like protein 1.
ATCAACGACCGGCTGGACAAGCGGACGTGGACGTACATCTTCGGCGCGTGCTGCGCCACC
ACGGTGTTCATCCCGTCGTTCCACAACTACCGGATCTGGTCCTTCCTGGGCCTCGGCATG
ACCACCTATACCGCTTGGTACCTCGCCATCGCCGCCCTCCTCAACGGCCAGGCCGAAGGC
ATCACCCACACCGGTCCAACCAAGCTGGTGCTGTACTTCACCGGCGCCACCAACATCCTC
TACACCTTCGGCGGCCACGCCGTCACAGTGGAGATCATGCACGCGATGTGGAAACCGGCC
AAGTTCAAGTACATCTACCTGCTGGCGACGCTGTACGTGTTCACGCTGACGCTGCCGTCG
GCGTCGGCCATGTACTGGGCGTTCGGGGACGAGCTGCTGACCCACTCCAACGCCTTCTCG
CTGCTGCCCAAGACCGGGTGGCGCGACGCGGCGGTGATACTGATGCTGATCCACCAGTTC
ATCACGTTCGGGTTCGCGTGCACGCCGCTCTACTTCGTGTGGGAGAAGGTGATCGGCATG
CACGACACCAAGAGCATCTGCCTCAGGGCGCTCGCGCGGCTCCCCATCGTCGTCCCCATC
TGGTTCCTCGCCATCATCTTCCCCTTCTTCGGCCCCATCAACTCCGCCGTCGGCGCGCTC
CTCGTCAGCTTCACCGTCTACATCATCCCGGCACTCGCCCACATCCTCACCTACCGTACG
GCCTCCGCGCGCATGAACGCGGCGGAGAAGCCACCGTTCTTCCTGCCGAGCTGGACGGGG
ATGTTCGTGCTCAACATGTTCATCGTGGTGTGGGTGCTCGTGGTGGGCTTCGGGCTCGGC
GGCTGGGCCAGCATGGTCAACTTCATCAGGCAGATCGACACGTTCGGGCTCTTCGCCAAG
TGCTACCAGTGTCCCAAGCCCGCCCCGGCGTTGGCGCAGTCGCCGGTGCCATTGCCGCAC
CACTAG

Protein

322 aa

>Os01t0856500-04 Similar to auxin transporter-like protein 1.
INDRLDKRTWTYIFGACCATTVFIPSFHNYRIWSFLGLGMTTYTAWYLAIAALLNGQAEG
ITHTGPTKLVLYFTGATNILYTFGGHAVTVEIMHAMWKPAKFKYIYLLATLYVFTLTLPS
ASAMYWAFGDELLTHSNAFSLLPKTGWRDAAVILMLIHQFITFGFACTPLYFVWEKVIGM
HDTKSICLRALARLPIVVPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPALAHILTYRT
ASARMNAAEKPPFFLPSWTGMFVLNMFIVVWVLVVGFGLGGWASMVNFIRQIDTFGLFAK
CYQCPKPAPALAQSPVPLPHH*

5'UTR

chr01:37000257..37000257 (+ strand) : 1 bp

CDS

chr01:37000258..37000428 (+ strand) : 171 bp

chr01:37000540..37000637 (+ strand) : 98 bp

chr01:37002304..37002769 (+ strand) : 466 bp

chr01:37003886..37004116 (+ strand) : 231 bp

3'UTR

chr01:37004117..37004643 (+ strand) : 527 bp

FASTA

>Os01t0856500-04 class=Sequence position=chr01:37000257..37004643 (+ strand)
CATCAACGAC CGGCTGGACA AGCGGACGTG GACGTACATC TTCGGCGCGT GCTGCGCCAC CACGGTGTTC ATCCCGTCGT
TCCACAACTA CCGGATCTGG TCCTTCCTGG GCCTCGGCAT GACCACCTAT ACCGCTTGGT ACCTCGCCAT CGCCGCCCTC
CTCAACGGCC AGGTGAGATA AGAAGAGGGA AACTGTCCTT GTCACTTTCT CGATCATCCA TCGCGTCTAC TACATGTCCA
TTTAGCTTGG GTTTGCAGTG ACTGATGATC GTTTGCGTCG CAGGCCGAAG GCATCACCCA CACCGGTCCA ACCAAGCTGG
TGCTGTACTT CACCGGCGCC ACCAACATCC TCTACACCTT CGGCGGCCAC GCCGTCACAG TGTAAGCAAA GCAGAACTTG
CTCTGTTTGT CCAGTTGTTA ATACTGTACA GTAGTATTAG TACTAGGACT ACAAGCTAAT CCTCCTGAGG AAGTGAAGTG
AGGGAGAACT TTTCACTAGC TGCAGCTTTT GCCTGCCAAT GTGGAGGACA TGTCCCGATT GGAAATCAGG TTCTGGTTTC
CATTCCATTG GTCCCCCTCC ATGGTACTGG TACTCGCACC TCACTGGTCA CAGTGTAGTA TAGTGAGTAC TACTACTACT
ACTAAGCTTA ATTAAAACAC ACGTAGCTGT AGCTTTGCAG CTAGTTAGCT CTATGGCGTA CAGATCCCAA TGGATGGATA
GGGGCACTTA AAAATTCCAA GCCTGTGCGC GGTGGGAAAC AGCTGCGTTA GCTTGCGACC ATTAGTCGGC TGATCGATTG
ATATCGGTCG ATAAAAATTT ATAAAGATCG ATCCAGCTGC TAAAGCTCGG TGCGTTCATG TGCATGTGCG ATGTGCTGAA
CTGGTGATGC ATCCAAAAGG TCCCCTGCTA GTACACGCGA TGGTTTAGGG GAGAAAAGAA TGGGCCACTA TGCATTAGAA
TAGACTCCTT GAGCCCCTTT ATTCCCATTG CTCGTTTATG TGCCTAATCT ATTGCTTGGA TTATTGAGTG TGTTTTTGCT
TTGGCATGAT TAGAGGCCCA TGCGAGGAAT AATTAGCGTT TCAGTGCGCT GTTCCTTCAA AATGCGATGG TCGTTAGTGC
CTTAGTGGTC GCATGCAGTT CGGATTGGAG ATTTGATGAT CTTATAGTAG TATATATAGT ATCTCCTAGC TTCAAAAATT
TAATGTAGTG CTACCAGTAC TTGTTCCATA GTTGTGAAAA TTGAAAATGC TTTTGATGGG TTGGAAATGG AATGGAATGA
TAAGGGGGGC CAGCTTCATT CAATTCAGCT AGTGCGGAGT TCACATCAAG CTATGCAATT CCGTGCTAGT TGCCCTAATC
CAACGGGGTG AAATGATTTC CATCATGGAT TGGGACATCT TGGTGCCAAA TCATCCAATG ATGATTCCAT TTATATCTTA
CTACTACTAT TATGCTGCTA GGCTTGCATG GGAAAGTTTA GCTTAGTGGG GCGAAGGGGA CACAGACCTG CTTTGAGAAT
TGCTTCCCAA TTGAAGAATG TGAGTGTCTT TGTCCATCTT GACAATGCCC CTCACCACTT CTGGTCTCAG GCTAATTCAA
AGCCCAGTTT GGTAGCGACA TGAGACCATT AGCATAACAT GCATGGGATG GGATCTTCGC TAGCTGTGGA GCAGAGTTTT
TAGGTGATTA GTACTCGTAT TTAGTGGTAT AAATTATTAT TGGCAACGGC CTTATTTGGC CGTATTTGTC GGCTCCTCCA
TCATTTGACC GGTGGCGGAT ACATGTGTTG GTGAAAGAAA GAAAGCAATT GCGAGATTCC CCCTGCCGCC GCGATCCTTG
CATGTATCCT GCCTGCGTGA CTAGGAGAAG CAGCAGCTGT AGTAGTAGTC CTACTTTTTG GCCGTATCAT TTGATCAAGC
TGATTAAAGT CTCAGCATCA TTGACTCGCA TGTGCCGAGG CCGTTTTGTC CGTTGATTTG TTGATTAATA ACCTGCAAGA
AAAGAAAATA ATGACTGATT GGGGGTGGCT GTTTTGGATT GGTGCAGGGA GATCATGCAC GCGATGTGGA AACCGGCCAA
GTTCAAGTAC ATCTACCTGC TGGCGACGCT GTACGTGTTC ACGCTGACGC TGCCGTCGGC GTCGGCCATG TACTGGGCGT
TCGGGGACGA GCTGCTGACC CACTCCAACG CCTTCTCGCT GCTGCCCAAG ACCGGGTGGC GCGACGCGGC GGTGATACTG
ATGCTGATCC ACCAGTTCAT CACGTTCGGG TTCGCGTGCA CGCCGCTCTA CTTCGTGTGG GAGAAGGTGA TCGGCATGCA
CGACACCAAG AGCATCTGCC TCAGGGCGCT CGCGCGGCTC CCCATCGTCG TCCCCATCTG GTTCCTCGCC ATCATCTTCC
CCTTCTTCGG CCCCATCAAC TCCGCCGTCG GCGCGCTCCT CGTCAGCTTC ACCGTCTACA TCATCCCGGC ACTCGCCCAC
ATCCTCACCT ACCGTACGGC CTCCGCGCGC ATGGTAACCT CAAGAACCTC TCTGCACATG CCCTAACTAT GCCCCATCAT
CATCGCTGCA TGCATGTTTT TGTTCCGGTA CACCGCCTCG TCCATCCATC CACGCATTCA ATGGCAGGTA CTAGTGCAAG
CTAGGGCGAA TGCAACGTGA CGGCCAACTT ATACTAACAA CTGGGTCCGA TGGATTTCAT CGACGCTTCC TCCGTGTTGC
TATAGCTGAG CAGCGGATCG GTCGAGCCAT CATCAACAGT GGCGAGACTG GAACACACAG GCAATAGAAT AGACAGTGGA
GATCTGTGCG CAGGCAGCAG AAGCAAGCAG CAGTTCGTGT TGAATGCAAA AGCACAGCCG GGCCGTGCCC GGGGCCCACC
TCATACATGG GCAAATCCCC AATCATTGAA TCCAGCCAAC AACCACATTA ATTCCAAGCA GCGCCCCCCC CCCCCCCCCC
CTCCCCTCTC GATTCTGGCC GCTGCTTTGG CAGTATCTTC CCCAAGAGAG GTTAGCTTAG CCTAGTCACT TTGGTTTAGT
GACCGTGCCC AGTTCTGGTG CGCTACTGCT CCCATGTATA GTGTCTCAGA TTAGGAGCCC AACCAAAGGT GGTCCCTGCT
TATCTGGCTG GCTGCTGCCG CGCGGCTCGG TACAGCGGAC GAATCCACCC GTAGACTCTC TGTGCACCGT GCGCGACGAC
GCGAAGAAAC GCGCGGAAAG CAACGGTTGA CGCCGCGGTG GATGAGGTGG GACGGACGCG CTGCTGATGT TTTCGCGCCG
GCGCTGCTAT CGCGGGTGGG ACATATGTAA GACTTCCGCT TGGCGCGTAG CCGGAGGCGA TGGCGCGGTG GTCGCCGTCG
CGCCCGTCAG GTCAGGGGGC GCGCGCGGCT AGCTTAGCTT TTTTCGCGCG TGGGGGGAGG GGTTTGGGAG ATTTTTGTGC
GTGGGTAGCC TTTCCCTCTC GATCCCCTTC CTTTTTCCGC GCCTTTCCGA AAGGCGATCG ACCGAACGTG CGTGGTAGTA
CGGACGCGGC ACGGCGAATA AAACCAGCAA GCACCAACCA TGTTTTATGT TGAGAATCTA CAATACGCAT CTCTTTTTTG
ACGAGGGTTT ATGTTGTTGT TTGCAACAGA ACGCGGCGGA GAAGCCACCG TTCTTCCTGC CGAGCTGGAC GGGGATGTTC
GTGCTCAACA TGTTCATCGT GGTGTGGGTG CTCGTGGTGG GCTTCGGGCT CGGCGGCTGG GCCAGCATGG TCAACTTCAT
CAGGCAGATC GACACGTTCG GGCTCTTCGC CAAGTGCTAC CAGTGTCCCA AGCCCGCCCC GGCGTTGGCG CAGTCGCCGG
TGCCATTGCC GCACCACTAG CGCGCGCCCG TTCCGCACCA CCGCCGCCGC CGCGGCGGAC CGTGACAACG TGCACCGCCG
AGCCCGGAGC AAGGAACCTC GCTCTCCTGG CCGGCACGGC TGCAAAAATT CAGTGTTGCT TAGGTTTTGG TCGCCTTGTA
ATATACAAAG CCTCTCCTCC TGTGCTAGGG TGTCACACCA AAATGGTAGA AGAAGAAGAG GGCATGGGTC CCTACGATCT
TGCCCCGGGC CGTCCGCTGC CGCGTTGCTT TCCCCCGATC CTCGATGGTG TCCTTGTGTT TGTTTGGCTT GCCCCTCCCT
CTGGCGATAT ATATGTGATG GTCGTCATGG CTTATAAAGA TTTTCAGCTC ATGTCACATT TTCATATGAT ATGATGTAGC
ATATCACTAT AGGGTTATTT GTTTTCTACC TGGATGGAGC TTGGTCCATG TTGTCTAGCG CGAGCAATTG TAATCGGCGA
TTCCTCGTGC TAGCTAAAGG CAAAACACGG AGGCCTTTGT TTATTGCGTT CCGCTTTGGA TGTTCTT

Locus: Os01g0856500

Loading...

Locus: Os01g0856500

Loading...