Os01t0859300-02

Locus

Os01g0859300

Description

bZIP transcription factor, Stress response and ABA signal transduction, Regulation of plant fertility

RAP-DB Gene Symbol Synonym(s)

OsABI5-1, OsABI5

RAP-DB Gene Name Synonym(s)

ABA Insensitive 5, Abscisic acid insensitive 5

CGSNL Gene Symbol

ABI5

CGSNL Gene Name

ABA INSENSITIVE 5

Oryzabase Gene Symbol Synonym(s)

OsABI5, OsbZIP10, OsABF1, OREB1, OsABI5-1, OsABI5-2, OsOREB1, OREB1

Oryzabase Gene Name Synonym(s)

ABA Insensitive 5, bZIP-type transcription factor ABI5, bZIP transcription factors OsABI5, bZIP transcription factor 10, Abscisic acid insensitive 5

Transcript Evidence

EF199630

Protein Evidence

A2TGS0

Literature

PMID: 18236009

PMID: 17604002

Note

Manual Curation

January 24, 2018

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-templated (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: transcription factor activity, sequence-specific DNA binding (GO:0003700)

Functional domain (InterPro)

Transcription factor, Skn-1-like, DNA-binding domain superfamily (IPR008917)

Basic-leucine zipper domain (IPR004827)

Experimentally confirmed subcellular location

nucleus

Others

Oryzabase (8259)

Transcript

1387 bp

>Os01t0859300-02 bZIP transcription factor, Stress response and ABA signal transduction, Regulation of plant fertility
GAGTGTTATAGTGAGATGGCATCGGAGATGAGCAAGAACGTGAAGGTCACCGATGATCAA
GAGGTTACATCACAGGAGCGTGACCAAAGTGGTGGTACAAAAGTAGGTGGGGAGGAGGAA
ATTGCTCCACTGGCGCGGCAGTCGTCAATCCTCTCCCTCACCTTGGAAGAGCTACAAAAC
TCCTTGTGTGAGCCAGGACGCAACTTTGGTTCCATGAACATGGACGAGTTTGTGGCTAAC
ATATGGAATGCTGAAGAATTCCAGGCTACCACCGGAGGTTGCAAGGGTGCCATGGAGGAA
GCCAAGGTGGTAGACAGTGGAAGCGGAAGCGGTGATGCAGGAGGAAGCGGTTTATGTCGG
CAGGGATCATTTTCCTTGCCGCTACCGCTGTGCCAGAAGACGGTGGAGGAGGTGTGGACT
GAGATCAACCAAGCCCCTGCACACACCTCCGCTCCGGCCTCCGCGCTCCAGCCACATGCC
GGGAGCGGTGGTGTTGCAGCTAACGACCGACAGGTAACACTAGGTGAGATGACACTTGAG
GATTTCTTGGTAAAGGCCGGGGTGGTCCGAGGGTCCTTTACCGGGCAAGCGGCCATGGGA
TCTGGCATGGTCAACGGGCCGGTGAACCCCATGCAGCAGGGCCAAGGCGGTCCTATGATG
TTCCCAGTAGGACCGGTAAACGCCATGTATCCGGTGATGGGTGATGGCATGGGGTACCCC
GGTGGGTACAACGGGATGGCGATTGTGCCACCGCCACCTCCCGCCCAAGGTGCCATGGTT
GTCGTGAGTCCTGGATCATCAGATGGGATGAGTGCCATGACACATGCTGATATGATGAAT
TGTATTGGGAATGGGATGATGATTGAGAATGGAACAAGAAAGCGTCCCCACAGAGAGGAT
GGCTGCGCCGAGAAGACGGTGGAGCGCCGCCAACGGCGCATGATCAAGAACCGTGAGTCA
GCTGCACGGTCCCGTGCTAGAAAGCAGGCTTATACGGTGGAGCTCGAAGCTGAACTGAAC
TATCTCAAGCAGGAGAACGCTCGTCTCAAAGAGGCAGAGCTGGTTGAGAAAATGATGGAG
CAGTCCAAGGAGAAGATGAATGCAAATAGGGGTGGCAGCCAGCTGCGCCGCAGCGGCAGC
TGCATGTGGTGAAACGGGCATAGCGGTGACCGGCGAGTGGCACACTCATCCTGCTTCTGG
TGTGGCACTAGCCTCTGAGGCTCTGAAGAGGATTTGCACATTAAGTCTTCTTTCAGACTA
AGTGATGTGAAGGTATTATGGTAGTAGTTGATATACATATATGCTGTGATGCTTGTAAAC
CTGCCTGGACCCACATGTCTTGCCATCGTGTTCACCGGTCCTTGCTGCTTATATGGTTAC
ATGTCGC

CDS

1137 bp

>Os01t0859300-02 bZIP transcription factor, Stress response and ABA signal transduction, Regulation of plant fertility
ATGGCATCGGAGATGAGCAAGAACGTGAAGGTCACCGATGATCAAGAGGTTACATCACAG
GAGCGTGACCAAAGTGGTGGTACAAAAGTAGGTGGGGAGGAGGAAATTGCTCCACTGGCG
CGGCAGTCGTCAATCCTCTCCCTCACCTTGGAAGAGCTACAAAACTCCTTGTGTGAGCCA
GGACGCAACTTTGGTTCCATGAACATGGACGAGTTTGTGGCTAACATATGGAATGCTGAA
GAATTCCAGGCTACCACCGGAGGTTGCAAGGGTGCCATGGAGGAAGCCAAGGTGGTAGAC
AGTGGAAGCGGAAGCGGTGATGCAGGAGGAAGCGGTTTATGTCGGCAGGGATCATTTTCC
TTGCCGCTACCGCTGTGCCAGAAGACGGTGGAGGAGGTGTGGACTGAGATCAACCAAGCC
CCTGCACACACCTCCGCTCCGGCCTCCGCGCTCCAGCCACATGCCGGGAGCGGTGGTGTT
GCAGCTAACGACCGACAGGTAACACTAGGTGAGATGACACTTGAGGATTTCTTGGTAAAG
GCCGGGGTGGTCCGAGGGTCCTTTACCGGGCAAGCGGCCATGGGATCTGGCATGGTCAAC
GGGCCGGTGAACCCCATGCAGCAGGGCCAAGGCGGTCCTATGATGTTCCCAGTAGGACCG
GTAAACGCCATGTATCCGGTGATGGGTGATGGCATGGGGTACCCCGGTGGGTACAACGGG
ATGGCGATTGTGCCACCGCCACCTCCCGCCCAAGGTGCCATGGTTGTCGTGAGTCCTGGA
TCATCAGATGGGATGAGTGCCATGACACATGCTGATATGATGAATTGTATTGGGAATGGG
ATGATGATTGAGAATGGAACAAGAAAGCGTCCCCACAGAGAGGATGGCTGCGCCGAGAAG
ACGGTGGAGCGCCGCCAACGGCGCATGATCAAGAACCGTGAGTCAGCTGCACGGTCCCGT
GCTAGAAAGCAGGCTTATACGGTGGAGCTCGAAGCTGAACTGAACTATCTCAAGCAGGAG
AACGCTCGTCTCAAAGAGGCAGAGCTGGTTGAGAAAATGATGGAGCAGTCCAAGGAGAAG
ATGAATGCAAATAGGGGTGGCAGCCAGCTGCGCCGCAGCGGCAGCTGCATGTGGTGA

Protein

379 aa

>Os01t0859300-02 bZIP transcription factor, Stress response and ABA signal transduction, Regulation of plant fertility
MASEMSKNVKVTDDQEVTSQERDQSGGTKVGGEEEIAPLARQSSILSLTLEELQNSLCEP
GRNFGSMNMDEFVANIWNAEEFQATTGGCKGAMEEAKVVDSGSGSGDAGGSGLCRQGSFS
LPLPLCQKTVEEVWTEINQAPAHTSAPASALQPHAGSGGVAANDRQVTLGEMTLEDFLVK
AGVVRGSFTGQAAMGSGMVNGPVNPMQQGQGGPMMFPVGPVNAMYPVMGDGMGYPGGYNG
MAIVPPPPPAQGAMVVVSPGSSDGMSAMTHADMMNCIGNGMMIENGTRKRPHREDGCAEK
TVERRQRRMIKNRESAARSRARKQAYTVELEAELNYLKQENARLKEAELVEKMMEQSKEK
MNANRGGSQLRRSGSCMW*

5'UTR

chr01:37174575..37174589 (+ strand) : 15 bp

CDS

chr01:37174590..37175561 (+ strand) : 972 bp

chr01:37175650..37175721 (+ strand) : 72 bp

chr01:37176017..37176109 (+ strand) : 93 bp

3'UTR

chr01:37176110..37176344 (+ strand) : 235 bp

FASTA

>Os01t0859300-02 class=Sequence position=chr01:37174575..37176344 (+ strand)
GAGTGTTATA GTGAGATGGC ATCGGAGATG AGCAAGAACG TGAAGGTCAC CGATGATCAA GAGGTTACAT CACAGGAGCG
TGACCAAAGT GGTGGTACAA AAGTAGGTGG GGAGGAGGAA ATTGCTCCAC TGGCGCGGCA GTCGTCAATC CTCTCCCTCA
CCTTGGAAGA GCTACAAAAC TCCTTGTGTG AGCCAGGACG CAACTTTGGT TCCATGAACA TGGACGAGTT TGTGGCTAAC
ATATGGAATG CTGAAGAATT CCAGGCTACC ACCGGAGGTT GCAAGGGTGC CATGGAGGAA GCCAAGGTGG TAGACAGTGG
AAGCGGAAGC GGTGATGCAG GAGGAAGCGG TTTATGTCGG CAGGGATCAT TTTCCTTGCC GCTACCGCTG TGCCAGAAGA
CGGTGGAGGA GGTGTGGACT GAGATCAACC AAGCCCCTGC ACACACCTCC GCTCCGGCCT CCGCGCTCCA GCCACATGCC
GGGAGCGGTG GTGTTGCAGC TAACGACCGA CAGGTAACAC TAGGTGAGAT GACACTTGAG GATTTCTTGG TAAAGGCCGG
GGTGGTCCGA GGGTCCTTTA CCGGGCAAGC GGCCATGGGA TCTGGCATGG TCAACGGGCC GGTGAACCCC ATGCAGCAGG
GCCAAGGCGG TCCTATGATG TTCCCAGTAG GACCGGTAAA CGCCATGTAT CCGGTGATGG GTGATGGCAT GGGGTACCCC
GGTGGGTACA ACGGGATGGC GATTGTGCCA CCGCCACCTC CCGCCCAAGG TGCCATGGTT GTCGTGAGTC CTGGATCATC
AGATGGGATG AGTGCCATGA CACATGCTGA TATGATGAAT TGTATTGGGA ATGGGATGAT GATTGAGAAT GGAACAAGAA
AGCGTCCCCA CAGAGAGGAT GGCTGCGCCG AGAAGACGGT GGAGCGCCGC CAACGGCGCA TGATCAAGAA CCGTGAGTCA
GCTGCACGGT CCCGTGCTAG AAAGCAGGTA CACATGTTGC TCCGAACCTT TTAGTTTCTA TGTATCGTTA AGACATTTTG
CATGGAGATT GAAATTTTTA TGAATAATGC TACAGGCTTA TACGGTGGAG CTCGAAGCTG AACTGAACTA TCTCAAGCAG
GAGAACGCTC GTCTCAAAGA GGCAGAGGTA TTAAAGCAAG AAACATTATC CACTCAGCTT TCATTGTCAT TCCTAAACAG
TCTCGTTCCT TCCTTTTCTG TAACATTGAA CTGATAAATA TACAATGTCT ATATTATCTT CCTTTTACAG AAGACGGTTC
TACTGACAAA GAAGCAAATG GTATTGTCCT CTCCCATGTG GCAATCCCCA TTCCGCATAG TGCTCATCGT TTTGTGAAAT
TATTAAATAC ATATTTGTTA TTCATTTATT TGTGTGTGTA TATATGCTCA TGGAAATATG TCGTGTTCCT GTGATTTTTC
AGCTGGTTGA GAAAATGATG GAGCAGTCCA AGGAGAAGAT GAATGCAAAT AGGGGTGGCA GCCAGCTGCG CCGCAGCGGC
AGCTGCATGT GGTGAAACGG GCATAGCGGT GACCGGCGAG TGGCACACTC ATCCTGCTTC TGGTGTGGCA CTAGCCTCTG
AGGCTCTGAA GAGGATTTGC ACATTAAGTC TTCTTTCAGA CTAAGTGATG TGAAGGTATT ATGGTAGTAG TTGATATACA
TATATGCTGT GATGCTTGTA AACCTGCCTG GACCCACATG TCTTGCCATC GTGTTCACCG GTCCTTGCTG CTTATATGGT
TACATGTCGC