Os01t0864700-00

Locus

Os01g0864700

Description

Similar to Serine/threonine-protein kinase Nek5.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsNek5

Oryzabase Gene Name Synonym(s)

NIMA-related kinase 5

Transcript Evidence

CT834975 (DDBJ, Best hit)

Protein Evidence

Q94CU5 (UniProt)

Literature

Note

Manual Curation

Expression Databases

TENOR (Os01t0864700-00)

Others

Oryzabase (9929)

KEGG (Os01t0864700-00)

Transcript

614 bp

>Os01t0864700-00 Similar to Serine/threonine-protein kinase Nek5.
TCGGAAACTAATACCATCAGCTCGAAAACAGCCTGTTCAGATGTTGTAAAATTTCTTACT
GTCCCTGAAGTAAATTCTACTACTACTGCTATCAACAATGGATTCAAGGAGGAGGCAAGC
CCAACGAAGGAAATTCTAGATGTCAAGTCTTTCAGGCAGCGAGCCGAGGCCCTTGAAGGA
CTCCTGGAGCTTTCTGCGGATCTACTGCAACACAATAGGCTGGAGGAGCTTGCGGTTGTT
CTAAAGCCTTTCGGGAAGGATAAGGTATCTCCTCGAGAAACAGCAATCTGGTTGGCCAAA
AGTTTTAAAGGGATGATGAATGATGAAGCGAGTCGCAGTTCAATGTGAGTACATATAATA
CCCATATAAGGCCATAACATTAACCTTTTTCCGTTGTTTTTGGTTTGTGCTCTGCATCTC
GAATTGTTGCTTGATCACATCACCCTTATTTACATCGTGTGATCCATTGGTCCCATGTTT
GCGTCTTTAGTTTTCATTCTTTACGGTACATTTTGTAAATAGTCCAGACTCTTGAACAGA
AATAAGACATGTCAAAGTATGATGTAAATTTATATAATAATCAAGCTAATGAAATGACTG
GTTTGATCCAATGT

CDS

348 bp

>Os01t0864700-00 Similar to Serine/threonine-protein kinase Nek5.
TCGGAAACTAATACCATCAGCTCGAAAACAGCCTGTTCAGATGTTGTAAAATTTCTTACT
GTCCCTGAAGTAAATTCTACTACTACTGCTATCAACAATGGATTCAAGGAGGAGGCAAGC
CCAACGAAGGAAATTCTAGATGTCAAGTCTTTCAGGCAGCGAGCCGAGGCCCTTGAAGGA
CTCCTGGAGCTTTCTGCGGATCTACTGCAACACAATAGGCTGGAGGAGCTTGCGGTTGTT
CTAAAGCCTTTCGGGAAGGATAAGGTATCTCCTCGAGAAACAGCAATCTGGTTGGCCAAA
AGTTTTAAAGGGATGATGAATGATGAAGCGAGTCGCAGTTCAATGTGA

Protein

116 aa

>Os01t0864700-00 Similar to Serine/threonine-protein kinase Nek5.
SETNTISSKTACSDVVKFLTVPEVNSTTTAINNGFKEEASPTKEILDVKSFRQRAEALEG
LLELSADLLQHNRLEELAVVLKPFGKDKVSPRETAIWLAKSFKGMMNDEASRSSM*

CDS

chr01:37417302..37417649 (- strand) : 348 bp

3'UTR

chr01:37417036..37417301 (- strand) : 266 bp

FASTA

>Os01t0864700-00 class=Sequence position=chr01:37417036..37417649 (- strand)
TCGGAAACTA ATACCATCAG CTCGAAAACA GCCTGTTCAG ATGTTGTAAA ATTTCTTACT GTCCCTGAAG TAAATTCTAC
TACTACTGCT ATCAACAATG GATTCAAGGA GGAGGCAAGC CCAACGAAGG AAATTCTAGA TGTCAAGTCT TTCAGGCAGC
GAGCCGAGGC CCTTGAAGGA CTCCTGGAGC TTTCTGCGGA TCTACTGCAA CACAATAGGC TGGAGGAGCT TGCGGTTGTT
CTAAAGCCTT TCGGGAAGGA TAAGGTATCT CCTCGAGAAA CAGCAATCTG GTTGGCCAAA AGTTTTAAAG GGATGATGAA
TGATGAAGCG AGTCGCAGTT CAATGTGAGT ACATATAATA CCCATATAAG GCCATAACAT TAACCTTTTT CCGTTGTTTT
TGGTTTGTGC TCTGCATCTC GAATTGTTGC TTGATCACAT CACCCTTATT TACATCGTGT GATCCATTGG TCCCATGTTT
GCGTCTTTAG TTTTCATTCT TTACGGTACA TTTTGTAAAT AGTCCAGACT CTTGAACAGA AATAAGACAT GTCAAAGTAT
GATGTAAATT TATATAATAA TCAAGCTAAT GAAATGACTG GTTTGATCCA ATGT

Locus: Os01g0864700

Loading...

Locus: Os01g0864700

Loading...