Os01t0875700-01

Locus

Os01g0875700

Description

Heat shock protein DnaJ family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsDjB2

Oryzabase Gene Name Synonym(s)

DnaJ domain protein B2

Transcript Evidence

AK063817 (DDBJ, Best hit)

Protein Evidence

NP_001148785.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein folding (GO:0006457)

Molecular Function: heat shock protein binding (GO:0031072)

Molecular Function: unfolded protein binding (GO:0051082)

Functional domain (InterPro)

Heat shock protein DnaJ, N-terminal (IPR001623)

Chaperone DnaJ, C-terminal (IPR002939)

Heat shock protein DnaJ (IPR003095)

HSP40/DnaJ peptide-binding (IPR008971)

Full-length cDNA

001-121-H08 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0875700-01)

RiceXPro (AK063817)

Others

Oryzabase (12151)

KEGG (Os01t0875700-01)

Transcript

1329 bp

>Os01t0875700-01 Heat shock protein DnaJ family protein.
ACCCACACAGCCACACTCGCTGTGTTTCTCCTCTGCCGCTTAACCACCTCCCTCCGTAAC
AAACTCCTCATTTCGCTCCCCTCCCTTGCTCTTCTTCTTCTTCTTCTTCTTCTTCCTCCT
CCGCGACCACCACCGATCCATCCATCCACCGTGTCTTCTCTTCCCTCTCCAATGGGGAAC
CCTCCCGAGCTGTACCACCGCATCCTCAACATCCCCAGGGAGACCTCGCCGCAGGAAATC
CGCGCCGCCTACAAGAGCCTCGTCAAGAAATGGCACCCCGACAAGCACCCGCCGTCCTCC
AAGCCCGAGGCCGAGGCCCGCTTCAAGGCCATCACCGAGGCCTACGAGGCGCTCCTTGAC
CAGCAGGAGAACAGGGCGGTGTTCGGGGTGTGCTGCAACGACGGCCGCGCGGGCGAGAAG
GCCATGGCGTGCGGCGTGGTCGGCGGCGGAGGGGCACACATCGCGAGGACGCGCAGCGAC
GACTTCGGCGCGAGGATGGCGCCCGGCACGCCGGCGAGGGAGTTCAAGAAGGTGTACAGC
TCCGGCAACTCCGGCGGGCGGCGCGCGTTCGCCGAGTTCTCCAGCTCAATCATGCGCAAG
GCGCCGCCGCTGGAGCGCAAGCTCGACTGCACCCTCGAGGAGCTCTGCCACGGCTGCAAG
AAGGAGGTCAAGTTCACCCGCGACGTCGTCACCAAGAACGGGTCAATAGTCAAGAAGGAG
GTGAGCCAGATGGTGCTGGTGAAACCAGGGTGGAAGAAAGGGAACAAGATCACATTTGAA
GGCATGGGGGATGAGAGGCCAGGGTGCCTACCGGCCGATGCCGTCTTCGTCATATCGGAG
AAGAAACACCCTGTCTTCAAGAGGGTAGGCAACGACCTGGTGCTGAAAGCCGAGGTGCCA
TTGGTGAGCGCGCTCACCGGCTGGTCCTTCTCATTCAGGCTCCTGAGTGGCAAGAAGGTG
AGCTGCTCATTTCAGGATGAGATCATCTGCCCAGGATATGAGAAGATCATCAAAGGGGAA
GGGATGCCAATTGCCGATCAGAAAGGAGCACGGGGTGATCTAAGGGTGAAGTTTGAGATC
GCGTTCCCGAAGCAGCTTACTGACGAGCAACGCGACGGTCTTGCTCAAATTCTGAGAGGA
TGTGCATGGGATTGATGAGATTGAAATGCAAGGTCCAAGTGTATCAAATTTTCTCAGCCT
TGTGTTAAACAATCAGAATGAGTACATAAAGAGAGATGCCCTTGTATATACAGGTATAAT
ATATGATGAAAACCAAGTCTTCTGTGGATAGTACATGCCTTTCCAGATGAGCTGTATGGG
TTTATTTTG

CDS

984 bp

>Os01t0875700-01 Heat shock protein DnaJ family protein.
ATGGGGAACCCTCCCGAGCTGTACCACCGCATCCTCAACATCCCCAGGGAGACCTCGCCG
CAGGAAATCCGCGCCGCCTACAAGAGCCTCGTCAAGAAATGGCACCCCGACAAGCACCCG
CCGTCCTCCAAGCCCGAGGCCGAGGCCCGCTTCAAGGCCATCACCGAGGCCTACGAGGCG
CTCCTTGACCAGCAGGAGAACAGGGCGGTGTTCGGGGTGTGCTGCAACGACGGCCGCGCG
GGCGAGAAGGCCATGGCGTGCGGCGTGGTCGGCGGCGGAGGGGCACACATCGCGAGGACG
CGCAGCGACGACTTCGGCGCGAGGATGGCGCCCGGCACGCCGGCGAGGGAGTTCAAGAAG
GTGTACAGCTCCGGCAACTCCGGCGGGCGGCGCGCGTTCGCCGAGTTCTCCAGCTCAATC
ATGCGCAAGGCGCCGCCGCTGGAGCGCAAGCTCGACTGCACCCTCGAGGAGCTCTGCCAC
GGCTGCAAGAAGGAGGTCAAGTTCACCCGCGACGTCGTCACCAAGAACGGGTCAATAGTC
AAGAAGGAGGTGAGCCAGATGGTGCTGGTGAAACCAGGGTGGAAGAAAGGGAACAAGATC
ACATTTGAAGGCATGGGGGATGAGAGGCCAGGGTGCCTACCGGCCGATGCCGTCTTCGTC
ATATCGGAGAAGAAACACCCTGTCTTCAAGAGGGTAGGCAACGACCTGGTGCTGAAAGCC
GAGGTGCCATTGGTGAGCGCGCTCACCGGCTGGTCCTTCTCATTCAGGCTCCTGAGTGGC
AAGAAGGTGAGCTGCTCATTTCAGGATGAGATCATCTGCCCAGGATATGAGAAGATCATC
AAAGGGGAAGGGATGCCAATTGCCGATCAGAAAGGAGCACGGGGTGATCTAAGGGTGAAG
TTTGAGATCGCGTTCCCGAAGCAGCTTACTGACGAGCAACGCGACGGTCTTGCTCAAATT
CTGAGAGGATGTGCATGGGATTGA

Protein

328 aa

>Os01t0875700-01 Heat shock protein DnaJ family protein.
MGNPPELYHRILNIPRETSPQEIRAAYKSLVKKWHPDKHPPSSKPEAEARFKAITEAYEA
LLDQQENRAVFGVCCNDGRAGEKAMACGVVGGGGAHIARTRSDDFGARMAPGTPAREFKK
VYSSGNSGGRRAFAEFSSSIMRKAPPLERKLDCTLEELCHGCKKEVKFTRDVVTKNGSIV
KKEVSQMVLVKPGWKKGNKITFEGMGDERPGCLPADAVFVISEKKHPVFKRVGNDLVLKA
EVPLVSALTGWSFSFRLLSGKKVSCSFQDEIICPGYEKIIKGEGMPIADQKGARGDLRVK
FEIAFPKQLTDEQRDGLAQILRGCAWD*

5'UTR

chr01:38009641..38009811 (+ strand) : 171 bp

CDS

chr01:38009812..38009988 (+ strand) : 177 bp

chr01:38010079..38010431 (+ strand) : 353 bp

chr01:38011275..38011728 (+ strand) : 454 bp

3'UTR

chr01:38011729..38011902 (+ strand) : 174 bp

FASTA

>Os01t0875700-01 class=Sequence position=chr01:38009641..38011902 (+ strand)
ACCCACACAG CCACACTCGC TGTGTTTCTC CTCTGCCGCT TAACCACCTC CCTCCGTAAC AAACTCCTCA TTTCGCTCCC
CTCCCTTGCT CTTCTTCTTC TTCTTCTTCT TCTTCCTCCT CCGCGACCAC CACCGATCCA TCCATCCACC GTGTCTTCTC
TTCCCTCTCC AATGGGGAAC CCTCCCGAGC TGTACCACCG CATCCTCAAC ATCCCCAGGG AGACCTCGCC GCAGGAAATC
CGCGCCGCCT ACAAGAGCCT CGTCAAGAAA TGGCACCCCG ACAAGCACCC GCCGTCCTCC AAGCCCGAGG CCGAGGCCCG
CTTCAAGGCC ATCACCGAGG CCTACGAGGT GAGCCCCTAG CCGTGCGTTG CGTGCGTGCG TTGGCTGTAG ATTGCGACGG
CGTCGTGTCG TGATGTTGGG CGATTCTTGG TTGCGCAGGC GCTCCTTGAC CAGCAGGAGA ACAGGGCGGT GTTCGGGGTG
TGCTGCAACG ACGGCCGCGC GGGCGAGAAG GCCATGGCGT GCGGCGTGGT CGGCGGCGGA GGGGCACACA TCGCGAGGAC
GCGCAGCGAC GACTTCGGCG CGAGGATGGC GCCCGGCACG CCGGCGAGGG AGTTCAAGAA GGTGTACAGC TCCGGCAACT
CCGGCGGGCG GCGCGCGTTC GCCGAGTTCT CCAGCTCAAT CATGCGCAAG GCGCCGCCGC TGGAGCGCAA GCTCGACTGC
ACCCTCGAGG AGCTCTGCCA CGGCTGCAAG AAGGAGGTCA AGTTCACCCG CGACGTCGTC ACCAAGAACG GGTATACCCC
TTTCTTCCTC CACCTAATCC GTGAGCCAAG ATTGATTGGA GCTTTCACCT GAATTCTGGC GAGCAATCGC TTGTCATCCA
TCCATCCATT TTCCTCTTTT AAAACTAACA ATTCGATGCA ACCGGAACAA CCCTGATGTG ATTCGCTCAC TTGCATGCCA
ATTTTAATGG ATCGATGCTT GGAAACTTCA GAGTAGGCAA GAATTCAGAA TTTGTTCTGA TGGCGACATC CATTCCGCTT
TGTGCCTCCC CAATTCTCTG CACTGTTCGG AACAAAATGA TCCATGAACA GTGAAACAGC ACGACCACTT CCTTCCTTTC
CAGGCTATGG CGCACTTCTT TTTTACAGTG GAGGGTGACT GCTTTATTAT AGCCTGCATT TGTCAGTGGA ATATTTAGCT
TACTTTGGAA CACATGAAAA CCTTTTTACA CAAGTTCCCT TTGGTGTGTA CCTTTTCTCT TCCGGGGTAT CTATCCTATT
CTTGCAACAT TATCCTACCT AACACAAAGC ATAATAACAG CAGTGTTGAT CAGGGTTTAG TACATGTTAA GATCCAATCT
TGAGGAGATA AAATCTCAAC TCAAGTTGCT TTCGTTGCCA CTTATGCGTA TACGTGTTTG TCGAGGGCTT AGAATACAGT
AGTTTTGGAT CTAGCATCTA GCAAAGTGGA CCATTTGGGC AATAAGCACT ATCCACATTT TCTTTTGCAT GTTGATGGTG
GTGGTAGTCT AGGAAGGTTC AGTGACAGTG ACTATTAAGC ACCTTTCCTC CTTGGATTCT CTCTTTCAGT GTTGCTGGAC
TAATCACCTT CAATGGATTT ACAATCTTGG ACAGGTCAAT AGTCAAGAAG GAGGTGAGCC AGATGGTGCT GGTGAAACCA
GGGTGGAAGA AAGGGAACAA GATCACATTT GAAGGCATGG GGGATGAGAG GCCAGGGTGC CTACCGGCCG ATGCCGTCTT
CGTCATATCG GAGAAGAAAC ACCCTGTCTT CAAGAGGGTA GGCAACGACC TGGTGCTGAA AGCCGAGGTG CCATTGGTGA
GCGCGCTCAC CGGCTGGTCC TTCTCATTCA GGCTCCTGAG TGGCAAGAAG GTGAGCTGCT CATTTCAGGA TGAGATCATC
TGCCCAGGAT ATGAGAAGAT CATCAAAGGG GAAGGGATGC CAATTGCCGA TCAGAAAGGA GCACGGGGTG ATCTAAGGGT
GAAGTTTGAG ATCGCGTTCC CGAAGCAGCT TACTGACGAG CAACGCGACG GTCTTGCTCA AATTCTGAGA GGATGTGCAT
GGGATTGATG AGATTGAAAT GCAAGGTCCA AGTGTATCAA ATTTTCTCAG CCTTGTGTTA AACAATCAGA ATGAGTACAT
AAAGAGAGAT GCCCTTGTAT ATACAGGTAT AATATATGAT GAAAACCAAG TCTTCTGTGG ATAGTACATG CCTTTCCAGA
TGAGCTGTAT GGGTTTATTT TG

Locus: Os01g0875700

Loading...

Locus: Os01g0875700

Loading...