Os01t0883800-01

Locus

Os01g0883800

Description

Similar to GA C20oxidase2.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

SD1

CGSNL Gene Name

SEMIDWARF 1

Oryzabase Gene Symbol Synonym(s)

sd1, sd1 (d47, sd1-d, sd1-1), d49(sd1-r), d47, C20OX2, OsGA20ox-2, OsGA20ox2, GA20ox-2, GA20OX2, GA20ox2, sd-1, SD1-ja, SD1-in, sd1-2, Sd-1, GA20, 20ox2, Os20ox2

Oryzabase Gene Name Synonym(s)

dee-geo-woo-gen dwarf(sd1-d), green revolution gene, semidwarf-1, GA C20oxidase2, semidwarf-1, reimei dwarf(sd1-r), Calrose76(sd1-3), Jikkoku(sd1-2). rice GA 20-oxidase2, GA 20-oxidase 2, Gibberellin 20 oxidase 2, Gibberellin C-20 oxidase 2, GA 20-oxidase 2, Protein semidwarf-1, semi-dwarf1

Transcript Evidence

CT834906 (DDBJ, Best hit)

Protein Evidence

B6F2D9 (UniProt)

Literature

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: oxidoreductase activity (GO:0016491)

Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors (GO:0016706)

Functional domain (InterPro)

Oxoglutarate/iron-dependent oxygenase (IPR005123)

Expression Databases

TENOR (Os01t0883800-01)

Others

Oryzabase (470)

Transcript

1232 bp

>Os01t0883800-01 Similar to GA C20oxidase2.
CACACACACACACACTCACACTCACACACGCTCTCAACTCACTCCCGCTCAACACAGCGC
TCACTTCTCATCTCCAATCTCATGGTGGCCGAGCACCCCACGCCACCACAGCCGCACCAA
CCACCGCCCATGGACTCCACCGCCGGCTCTGGCATTGCCGCCCCGGCGGCGGCGGCGGTG
TGCGACCTGAGGATGGAGCCCAAGATCCCGGAGCCATTCGTGTGGCCGAACGGCGACGCG
AGGCCGGCGTCGGCGGCGGAGCTGGACATGCCCGTGGTCGACGTGGGCGTgctccgcgac
ggcgacgccgaggggctgcgccgcgccgcggcgcaggtggccgccgcgtgcgccacgcac
gggttcttccaggtTACTGCGAGGAGATGAAGGAGCTGTCGCTGACGATCATGGAACTCC
TGGAGCTGAGCCTGGGCGTGGAGCGAGGCTACTACAGGGAGTTCTTCGCGGACAGCAGCT
CAATCATGCGGTGCAACTACTACCCGCCAtgcccggagccggagcggacgctcggcacgg
gcccgcactgcgaccccaccgccctcaccatcctcctccaggacgacgtcggcggcctcg
aggtcctcgtcgacggcgaatggcgccccgtcagccccGTCCCCGGCGCCATGGTCATCA
ACATCGGCGACACCTTCATGGCGCTGTCGAACGGGAGGTATAAGAGCTGCCTGCACAGGG
CGGTGGTGAACCAGCGGCGGGAGCGGCGGTCGCTGGCGTTCTTCCTGTGCCCGCGGGAGG
ACAGGGTGGTGCGGCCGCCGCCGAGCGCCGCCACGCCGCAGCACTACCCGGACTTCACCT
GGGCCGACCTCATGCGCTTCACGCAGCGCCACTACCGCGCCGACACCCGCACGCTCGACG
CCTTCACGCGCTGGCTCGCGCCGCCGGCCGCCGACGCCGCCGCGACGGCGCAGGTCGAGG
CGGCCAGCTGATCGCCGAACGGAACGAAACGGAACGAACAGAAGCCGATTTTTGGCGGGG
CCCACGCCCACGTGAGGCCCCACGTGGACAGTGGGCCCGGGCGGAGGTGGCACCCACGTG
GACCGCGGGCCCCGCGCCGCCTTCCAATTTTGGACCCTACCGCTGTACATATTCATATAT
TGCAAGAAGAAGCAAAACGTACGTGTGGGTTGGGTTGGGCTTCTCTCTATTACTAAAAAA
AATATAATGGAACGACGGATGAATGGATGCTT

CDS

969 bp

>Os01t0883800-01 Similar to GA C20oxidase2.
CACACACACACACTCACACTCACACACGCTCTCAACTCACTCCCGCTCAACACAGCGCTC
ACTTCTCATCTCCAATCTCATGGTGGCCGAGCACCCCACGCCACCACAGCCGCACCAACC
ACCGCCCATGGACTCCACCGCCGGCTCTGGCATTGCCGCCCCGGCGGCGGCGGCGGTGTG
CGACCTGAGGATGGAGCCCAAGATCCCGGAGCCATTCGTGTGGCCGAACGGCGACGCGAG
GCCGGCGTCGGCGGCGGAGCTGGACATGCCCGTGGTCGACGTGGGCGTgctccgcgacgg
cgacgccgaggggctgcgccgcgccgcggcgcaggtggccgccgcgtgcgccacgcacgg
gttcttccaggtTACTGCGAGGAGATGAAGGAGCTGTCGCTGACGATCATGGAACTCCTG
GAGCTGAGCCTGGGCGTGGAGCGAGGCTACTACAGGGAGTTCTTCGCGGACAGCAGCTCA
ATCATGCGGTGCAACTACTACCCGCCAtgcccggagccggagcggacgctcggcacgggc
ccgcactgcgaccccaccgccctcaccatcctcctccaggacgacgtcggcggcctcgag
gtcctcgtcgacggcgaatggcgccccgtcagccccGTCCCCGGCGCCATGGTCATCAAC
ATCGGCGACACCTTCATGGCGCTGTCGAACGGGAGGTATAAGAGCTGCCTGCACAGGGCG
GTGGTGAACCAGCGGCGGGAGCGGCGGTCGCTGGCGTTCTTCCTGTGCCCGCGGGAGGAC
AGGGTGGTGCGGCCGCCGCCGAGCGCCGCCACGCCGCAGCACTACCCGGACTTCACCTGG
GCCGACCTCATGCGCTTCACGCAGCGCCACTACCGCGCCGACACCCGCACGCTCGACGCC
TTCACGCGCTGGCTCGCGCCGCCGGCCGCCGACGCCGCCGCGACGGCGCAGGTCGAGGCG
GCCAGCTGA

Protein

323 aa

>Os01t0883800-01 Similar to GA C20oxidase2.
HTHTLTLTHALNSLPLNTALTSHLQSHGGRAPHATTAAPTTAHGLHRRLWHCRPGGGGGV
RPEDGAQDPGAIRVAERRREAGVGGGAGHARGRRGRAPRRRRRGAAPRRGAGGRRVRHAR
VLPGYCEEMKELSLTIMELLELSLGVERGYYREFFADSSSIMRCNYYPPCPEPERTLGTG
PHCDPTALTILLQDDVGGLEVLVDGEWRPVSPVPGAMVINIGDTFMALSNGRYKSCLHRA
VVNQRRERRSLAFFLCPREDRVVRPPPSAATPQHYPDFTWADLMRFTQRHYRADTRTLDA
FTRWLAPPAADAAATAQVEAAS*

5'UTR

chr01:38382385..38382386 (+ strand) : 2 bp

CDS

chr01:38382387..38382758 (+ strand) : 372 bp

chr01:38383141..38383446 (+ strand) : 306 bp

chr01:38384918..38385208 (+ strand) : 291 bp

3'UTR

chr01:38385209..38385469 (+ strand) : 261 bp

FASTA

>Os01t0883800-01 class=Sequence position=chr01:38382385..38385469 (+ strand)
CACACACACA CACACTCACA CTCACACACG CTCTCAACTC ACTCCCGCTC AACACAGCGC TCACTTCTCA TCTCCAATCT
CATGGTGGCC GAGCACCCCA CGCCACCACA GCCGCACCAA CCACCGCCCA TGGACTCCAC CGCCGGCTCT GGCATTGCCG
CCCCGGCGGC GGCGGCGGTG TGCGACCTGA GGATGGAGCC CAAGATCCCG GAGCCATTCG TGTGGCCGAA CGGCGACGCG
AGGCCGGCGT CGGCGGCGGA GCTGGACATG CCCGTGGTCG ACGTGGGCGT gctccgcgac ggcgacgccg aggggctgcg
ccgcgccgcg gcgcaggtgg ccgccgcgtg cgccacgcac gggttcttcc aggtgtccga gcacggcgtc gacgccgctc
tggcgcgcgc cgcgctcgac ggcgccagcg acttcttccg cctcccgctc gccgagaagc gccgcgcgcg ccgcgtcccg
ggcaccgtgt ccggcTACAC CAGCGCCCAC GCCGACCGCT TCGCCTCCAA GCTCCCATGG AAGGAGACCC TCTCCTTCGG
CTTCCACGAC CGCGCCGCCG CCCCCGTCGT CGCCGACTAC TTCTCCAGCA CCCTCGGCCC CGACTTCGCG CCAATGGGGT
AATTAAAACG ATGGTGGACG ACATTGCATT TCAAATTCAA AACAAATTCA AAACACACCG ACCGAGATTA TGCTGAATTC
AAACGCGTTT GTGCGCGCAG GAGGGTGTAC CAGAAGTACT GCGAGGAGAT GAAGGAGCTG TCGCTGACGA TCATGGAACT
CCTGGAGCTG AGCCTGGGCG TGGAGCGAGG CTACTACAGG GAGTTCTTCG CGGACAGCAG CTCAATCATG CGGTGCAACT
ACTACCCGCC Atgcccggag ccggagcgga cgctcggcac gggcccgcac tgcgacccca ccgccctcac catcctcctc
caggacgacg tcggcggcct cgaggtcctc gtcgacggcg aatggcgccc cgtcagcccc GTCCCCGGCG CCATGGTCAT
CAACATCGGC GACACCTTCA TGGTAAACCA TCTCCTATTC TCCTCTCCTC TGTTCTCCTC TGCTTCGAAG CAACAGAACA
AGTAATTCAA GCTTTTTTTT CTCTCTCGCG CGAAATTGAC GAGAAAAATA AGATCGTGGT AGGGGCGGGG CTTTCAGCTG
AAAGCGGGAA GAAACCGACC TGACGTGATT TCTCTGTTCC AATCACAAAC AATGGAATGC CCCACTCCTC CATGTGTTAT
GATTTATCTC ACATCTTATA GTTAATAGGA GTAAGTAACA AGCTACTTTt ttcatattat agttcgtttg attttttttt
tttaaagttt ttttagtttt atccaaattt attgaaaaac ttagcaacgt ttataatacc aaattagtct catttagttt
aatattgtat atattttgat aatatattta tgttatatta aaaatattac tatatttttc tataaacatt attaaaaGCC
ATTTATAATA TAAAATGGAA GGAGTAATTA ATATGGATCT CCCCCGACAT GAGAATATTT TCCGATGGTG TGACGACGCC
ATGTAAGCTT CGGTGGGCCT GGACGGCCAG AGGTGCCAAC AGCCACGTCC AACAACCCCT GGGTCCCCCC CTAACACTCC
AAACAGTAGT GAGTAGTGTC TCGTCGCGTT TTAGTATTTG ATGACAAACA AAGTGTGAGT TGAGTTAGCC ACCACCAACT
TGCACACGAG CACATACATT TGTGTCCATT CTCGCCAGTC ACTTCCATCT CTAGTCCTAA CTCCTATCTA GCGATGTAAG
CGGATAATTT CATCATCCGT ATATAAACCT GTTTGTTATA GTTAATTTCC TATATAATAC TATAACAGTA TACATTTTAA
AAGAAAACAA AATTAGGATA AACAGGCCCT GCTCCTATCC ATCCATGGCA CTTGGAAGGA CCAGACTCGG TCATGCCATG
CCAAGCCAAG ATATGGGTTA TGGAAGAGTA GAGAAGAGGA GAGATGAGAG ATAAGCATGC GTTCTCCTCC TCGTTGGATG
TGTATTTTGG AGGGATTTGT GTAGTAGTAG CAGCGGCGCC GCGGGGACGG ATGCGGATGG TGGCGCTTTC GGTGGCGTTT
TCCCGGGGGG GTTTTGGTTT GGCGCTTGGG GGGGATGGCA TGGCGCGGCG TGCGGCTGCA CGCCACACAC ACGCGCGCGC
ACGCACGTAC GTCGTCGTCG CCGCGGGCGG ACGGTAGCTT AGGGTGGTGT GTTCCGCGCG CGGGCGCGGA TTGTTCCATG
CCGATCGATT TGGCGCCACC CTCGCCGCGG CTCTTGTCGC GTCGTGCGCC TCTCTCGCGC GGTTTGTCCT TGTCGCGTTG
CTCAGCCGGC GACGGGGGCA CGGACATTGG CGATGTAGCC CTGCACGTGT CGGCCTCTCC GTTGATGAAT GATGATGTAT
GTATGTATTT TTTTTTGTCT GAAGGAATTT GTGGGGAATT GTTGTGTGTG CAGGCGCTGT CGAACGGGAG GTATAAGAGC
TGCCTGCACA GGGCGGTGGT GAACCAGCGG CGGGAGCGGC GGTCGCTGGC GTTCTTCCTG TGCCCGCGGG AGGACAGGGT
GGTGCGGCCG CCGCCGAGCG CCGCCACGCC GCAGCACTAC CCGGACTTCA CCTGGGCCGA CCTCATGCGC TTCACGCAGC
GCCACTACCG CGCCGACACC CGCACGCTCG ACGCCTTCAC GCGCTGGCTC GCGCCGCCGG CCGCCGACGC CGCCGCGACG
GCGCAGGTCG AGGCGGCCAG CTGATCGCCG AACGGAACGA AACGGAACGA ACAGAAGCCG ATTTTTGGCG GGGCCCACGC
CCACGTGAGG CCCCACGTGG ACAGTGGGCC CGGGCGGAGG TGGCACCCAC GTGGACCGCG GGCCCCGCGC CGCCTTCCAA
TTTTGGACCC TACCGCTGTA CATATTCATA TATTGCAAGA AGAAGCAAAA CGTACGTGTG GGTTGGGTTG GGCTTCTCTC
TATTACTAAA AAAAATATAA TGGAACGACG GATGAATGGA TGCTT