Os01t0883800-02

Locus

Os01g0883800

Description

GA 20-oxidase2, GA metabolism

RAP-DB Gene Symbol Synonym(s)

20ox2, C20OX2, GA20, GA20ox-2, Os20ox2, OsGA20ox-2, OsGA20ox2, SD1, SD1-in, SD1-ja, Sd-1, d47, d49, sd-1, sd1, "sd1 (d47, sd1-d, sd1-1)", sd1-1, sd1-2, sd1-3, sd1-4

RAP-DB Gene Name Synonym(s)

Calrose76(sd1-3), GA 20-oxidase 2, GA C20oxidase2, Gibberellin 20 oxidase 2, Gibberellin 20-oxidase 2, Gibberellin C-20 oxidase 2, Jikkoku(sd1-2), Protein semidwarf-1, SEMIDWARF 1, Semidwarf 1, Semidwarf 1-1, Semidwarf 1-3, Semidwarf 1-4, dee-geo-woo-gen dwarf, gibberrellin (GA) 20-oxidase, green revolution gene, reimei dwarf, rice GA 20-oxidase2, semidwarf-1

CGSNL Gene Symbol

SD1

CGSNL Gene Name

SEMIDWARF 1

Oryzabase Gene Symbol Synonym(s)

sd1, sd1 (d47, sd1-d, sd1-1), d49(sd1-r), d47, C20OX2, OsGA20ox-2, OsGA20ox2, GA20ox-2, GA20OX2, GA20ox2, sd-1, SD1-ja, SD1-in, sd1-2, Sd-1, GA20, 20ox2, Os20ox2

Oryzabase Gene Name Synonym(s)

dee-geo-woo-gen dwarf(sd1-d), green revolution gene, semidwarf-1, GA C20oxidase2, semidwarf-1, reimei dwarf(sd1-r), Calrose76(sd1-3), Jikkoku(sd1-2). rice GA 20-oxidase2, GA 20-oxidase 2, Gibberellin 20 oxidase 2, Gibberellin C-20 oxidase 2, GA 20-oxidase 2, Protein semidwarf-1, semi-dwarf1

Transcript Evidence

AB077025 (DDBJ)

Protein Evidence

Q0JH50 (UniProt)

Literature

PMID: 11961544

PMID: 15075394

Note

Manual Curation

May 14, 2009

Gene Ontology (GO)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: iron ion binding (GO:0005506)

Molecular Function: oxidoreductase activity (GO:0016491)

Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors (GO:0016706)

Functional domain (InterPro)

Isopenicillin N synthase (IPR002283)

Oxoglutarate/iron-dependent oxygenase (IPR005123)

Expression Databases

TENOR (Os01t0883800-02)

Others

Oryzabase (470)

Transcript

1170 bp

>Os01t0883800-02 GA 20-oxidase2, GA metabolism
ATGGTGGCCGAGCACCCCACGCCACCACAGCCGCACCAACCACCGCCCATGGACTCCACC
GCCGGCTCTGGCATTGCCGCCCCGGCGGCGGCGGCGGTGTGCGACCTGAGGATGGAGCCC
AAGATCCCGGAGCCATTCGTGTGGCCGAACGGCGACGCGAGGCCGGCGTCGGCGGCGGAG
CTGGACATGCCCGTGGTCGACGTGGGCGTgctccgcgacggcgacgccgaggggctgcgc
cgcgccgcggcgcaggtggccgccgcgtgcgccacgcacgggttcttccaggtgtccgag
cacggcgtcgacgccgctctggcgcgcgccgcgctcgacggcgccagcgacttcttccgc
ctcccgctcgccgagaagcgccgcgcgcgccgcgtcccgggcaccgtgtccggcTACACC
AGCGCCCACGCCGACCGCTTCGCCTCCAAGCTCCCATGGAAGGAGACCCTCTCCTTCGGC
TTCCACGACCGCGCCGCCGCCCCCGTCGTCGCCGACTACTTCTCCAGCACCCTCGGCCCC
GACTTCGCGCCAATGGGGAGGGTGTACCAGAAGTACTGCGAGGAGATGAAGGAGCTGTCG
CTGACGATCATGGAACTCCTGGAGCTGAGCCTGGGCGTGGAGCGAGGCTACTACAGGGAG
TTCTTCGCGGACAGCAGCTCAATCATGCGGTGCAACTACTACCCGCCAtgcccggagccg
gagcggacgctcggcacgggcccgcactgcgaccccaccgccctcaccatcctcctccag
gacgacgtcggcggcctcgaggtcctcgtcgacggcgaatggcgccccgtcagccccGTC
CCCGGCGCCATGGTCATCAACATCGGCGACACCTTCATGGCGCTGTCGAACGGGAGGTAT
AAGAGCTGCCTGCACAGGGCGGTGGTGAACCAGCGGCGGGAGCGGCGGTCGCTGGCGTTC
TTCCTGTGCCCGCGGGAGGACAGGGTGGTGCGGCCGCCGCCGAGCGCCGCCACGCCGCAG
CACTACCCGGACTTCACCTGGGCCGACCTCATGCGCTTCACGCAGCGCCACTACCGCGCC
GACACCCGCACGCTCGACGCCTTCACGCGCTGGCTCGCGCCGCCGGCCGCCGACGCCGCC
GCGACGGCGCAGGTCGAGGCGGCCAGCTGA

CDS

1170 bp

>Os01t0883800-02 GA 20-oxidase2, GA metabolism
ATGGTGGCCGAGCACCCCACGCCACCACAGCCGCACCAACCACCGCCCATGGACTCCACC
GCCGGCTCTGGCATTGCCGCCCCGGCGGCGGCGGCGGTGTGCGACCTGAGGATGGAGCCC
AAGATCCCGGAGCCATTCGTGTGGCCGAACGGCGACGCGAGGCCGGCGTCGGCGGCGGAG
CTGGACATGCCCGTGGTCGACGTGGGCGTgctccgcgacggcgacgccgaggggctgcgc
cgcgccgcggcgcaggtggccgccgcgtgcgccacgcacgggttcttccaggtgtccgag
cacggcgtcgacgccgctctggcgcgcgccgcgctcgacggcgccagcgacttcttccgc
ctcccgctcgccgagaagcgccgcgcgcgccgcgtcccgggcaccgtgtccggcTACACC
AGCGCCCACGCCGACCGCTTCGCCTCCAAGCTCCCATGGAAGGAGACCCTCTCCTTCGGC
TTCCACGACCGCGCCGCCGCCCCCGTCGTCGCCGACTACTTCTCCAGCACCCTCGGCCCC
GACTTCGCGCCAATGGGGAGGGTGTACCAGAAGTACTGCGAGGAGATGAAGGAGCTGTCG
CTGACGATCATGGAACTCCTGGAGCTGAGCCTGGGCGTGGAGCGAGGCTACTACAGGGAG
TTCTTCGCGGACAGCAGCTCAATCATGCGGTGCAACTACTACCCGCCAtgcccggagccg
gagcggacgctcggcacgggcccgcactgcgaccccaccgccctcaccatcctcctccag
gacgacgtcggcggcctcgaggtcctcgtcgacggcgaatggcgccccgtcagccccGTC
CCCGGCGCCATGGTCATCAACATCGGCGACACCTTCATGGCGCTGTCGAACGGGAGGTAT
AAGAGCTGCCTGCACAGGGCGGTGGTGAACCAGCGGCGGGAGCGGCGGTCGCTGGCGTTC
TTCCTGTGCCCGCGGGAGGACAGGGTGGTGCGGCCGCCGCCGAGCGCCGCCACGCCGCAG
CACTACCCGGACTTCACCTGGGCCGACCTCATGCGCTTCACGCAGCGCCACTACCGCGCC
GACACCCGCACGCTCGACGCCTTCACGCGCTGGCTCGCGCCGCCGGCCGCCGACGCCGCC
GCGACGGCGCAGGTCGAGGCGGCCAGCTGA

Protein

390 aa

>Os01t0883800-02 GA 20-oxidase2, GA metabolism
MVAEHPTPPQPHQPPPMDSTAGSGIAAPAAAAVCDLRMEPKIPEPFVWPNGDARPASAAE
LDMPVVDVGVLRDGDAEGLRRAAAQVAAACATHGFFQVSEHGVDAALARAALDGASDFFR
LPLAEKRRARRVPGTVSGYTSAHADRFASKLPWKETLSFGFHDRAAAPVVADYFSSTLGP
DFAPMGRVYQKYCEEMKELSLTIMELLELSLGVERGYYREFFADSSSIMRCNYYPPCPEP
ERTLGTGPHCDPTALTILLQDDVGGLEVLVDGEWRPVSPVPGAMVINIGDTFMALSNGRY
KSCLHRAVVNQRRERRSLAFFLCPREDRVVRPPPSAATPQHYPDFTWADLMRFTQRHYRA
DTRTLDAFTRWLAPPAADAAATAQVEAAS*

CDS

chr01:38382466..38383022 (+ strand) : 557 bp

chr01:38383125..38383446 (+ strand) : 322 bp

chr01:38384918..38385208 (+ strand) : 291 bp

FASTA

>Os01t0883800-02 class=Sequence position=chr01:38382466..38385208 (+ strand)
ATGGTGGCCG AGCACCCCAC GCCACCACAG CCGCACCAAC CACCGCCCAT GGACTCCACC GCCGGCTCTG GCATTGCCGC
CCCGGCGGCG GCGGCGGTGT GCGACCTGAG GATGGAGCCC AAGATCCCGG AGCCATTCGT GTGGCCGAAC GGCGACGCGA
GGCCGGCGTC GGCGGCGGAG CTGGACATGC CCGTGGTCGA CGTGGGCGTg ctccgcgacg gcgacgccga ggggctgcgc
cgcgccgcgg cgcaggtggc cgccgcgtgc gccacgcacg ggttcttcca ggtgtccgag cacggcgtcg acgccgctct
ggcgcgcgcc gcgctcgacg gcgccagcga cttcttccgc ctcccgctcg ccgagaagcg ccgcgcgcgc cgcgtcccgg
gcaccgtgtc cggcTACACC AGCGCCCACG CCGACCGCTT CGCCTCCAAG CTCCCATGGA AGGAGACCCT CTCCTTCGGC
TTCCACGACC GCGCCGCCGC CCCCGTCGTC GCCGACTACT TCTCCAGCAC CCTCGGCCCC GACTTCGCGC CAATGGGGTA
ATTAAAACGA TGGTGGACGA CATTGCATTT CAAATTCAAA ACAAATTCAA AACACACCGA CCGAGATTAT GCTGAATTCA
AACGCGTTTG TGCGCGCAGG AGGGTGTACC AGAAGTACTG CGAGGAGATG AAGGAGCTGT CGCTGACGAT CATGGAACTC
CTGGAGCTGA GCCTGGGCGT GGAGCGAGGC TACTACAGGG AGTTCTTCGC GGACAGCAGC TCAATCATGC GGTGCAACTA
CTACCCGCCA tgcccggagc cggagcggac gctcggcacg ggcccgcact gcgaccccac cgccctcacc atcctcctcc
aggacgacgt cggcggcctc gaggtcctcg tcgacggcga atggcgcccc gtcagccccG TCCCCGGCGC CATGGTCATC
AACATCGGCG ACACCTTCAT GGTAAACCAT CTCCTATTCT CCTCTCCTCT GTTCTCCTCT GCTTCGAAGC AACAGAACAA
GTAATTCAAG CTTTTTTTTC TCTCTCGCGC GAAATTGACG AGAAAAATAA GATCGTGGTA GGGGCGGGGC TTTCAGCTGA
AAGCGGGAAG AAACCGACCT GACGTGATTT CTCTGTTCCA ATCACAAACA ATGGAATGCC CCACTCCTCC ATGTGTTATG
ATTTATCTCA CATCTTATAG TTAATAGGAG TAAGTAACAA GCTACTTTtt tcatattata gttcgtttga tttttttttt
ttaaagtttt tttagtttta tccaaattta ttgaaaaact tagcaacgtt tataatacca aattagtctc atttagttta
atattgtata tattttgata atatatttat gttatattaa aaatattact atatttttct ataaacatta ttaaaaGCCA
TTTATAATAT AAAATGGAAG GAGTAATTAA TATGGATCTC CCCCGACATG AGAATATTTT CCGATGGTGT GACGACGCCA
TGTAAGCTTC GGTGGGCCTG GACGGCCAGA GGTGCCAACA GCCACGTCCA ACAACCCCTG GGTCCCCCCC TAACACTCCA
AACAGTAGTG AGTAGTGTCT CGTCGCGTTT TAGTATTTGA TGACAAACAA AGTGTGAGTT GAGTTAGCCA CCACCAACTT
GCACACGAGC ACATACATTT GTGTCCATTC TCGCCAGTCA CTTCCATCTC TAGTCCTAAC TCCTATCTAG CGATGTAAGC
GGATAATTTC ATCATCCGTA TATAAACCTG TTTGTTATAG TTAATTTCCT ATATAATACT ATAACAGTAT ACATTTTAAA
AGAAAACAAA ATTAGGATAA ACAGGCCCTG CTCCTATCCA TCCATGGCAC TTGGAAGGAC CAGACTCGGT CATGCCATGC
CAAGCCAAGA TATGGGTTAT GGAAGAGTAG AGAAGAGGAG AGATGAGAGA TAAGCATGCG TTCTCCTCCT CGTTGGATGT
GTATTTTGGA GGGATTTGTG TAGTAGTAGC AGCGGCGCCG CGGGGACGGA TGCGGATGGT GGCGCTTTCG GTGGCGTTTT
CCCGGGGGGG TTTTGGTTTG GCGCTTGGGG GGGATGGCAT GGCGCGGCGT GCGGCTGCAC GCCACACACA CGCGCGCGCA
CGCACGTACG TCGTCGTCGC CGCGGGCGGA CGGTAGCTTA GGGTGGTGTG TTCCGCGCGC GGGCGCGGAT TGTTCCATGC
CGATCGATTT GGCGCCACCC TCGCCGCGGC TCTTGTCGCG TCGTGCGCCT CTCTCGCGCG GTTTGTCCTT GTCGCGTTGC
TCAGCCGGCG ACGGGGGCAC GGACATTGGC GATGTAGCCC TGCACGTGTC GGCCTCTCCG TTGATGAATG ATGATGTATG
TATGTATTTT TTTTTGTCTG AAGGAATTTG TGGGGAATTG TTGTGTGTGC AGGCGCTGTC GAACGGGAGG TATAAGAGCT
GCCTGCACAG GGCGGTGGTG AACCAGCGGC GGGAGCGGCG GTCGCTGGCG TTCTTCCTGT GCCCGCGGGA GGACAGGGTG
GTGCGGCCGC CGCCGAGCGC CGCCACGCCG CAGCACTACC CGGACTTCAC CTGGGCCGAC CTCATGCGCT TCACGCAGCG
CCACTACCGC GCCGACACCC GCACGCTCGA CGCCTTCACG CGCTGGCTCG CGCCGCCGGC CGCCGACGCC GCCGCGACGG
CGCAGGTCGA GGCGGCCAGC TGA