Os01t0884300-01

Locus

Os01g0884300

Description

No apical meristem (NAM) protein domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

NAC6

CGSNL Gene Name

NAC DOMAIN-CONTAINING PROTEIN 6

Oryzabase Gene Symbol Synonym(s)

OsNAC6, ONAC048, NAC48, SNAC2, SNAC2/OsNAC6, OsNAC6/ONAC048, OsSNAC2, SNAC-2, OsSNAC-2

Oryzabase Gene Name Synonym(s)

NAC 6, OsNac gene-6, O. sativa gene with the NAC domain 6, OsNAC6 protein, NAC domain-containing protein 48, stress-responsive NAC transcription factor SNAC2, stress-responsive NAC transcription factor 2

Transcript Evidence

AK068392 (DDBJ, Best hit)

Protein Evidence

Q7F2L3 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Functional domain (InterPro)

No apical meristem (NAM) protein (IPR003441)

Full-length cDNA

J013149P14 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0884300-01)

RiceXPro (AK068392)

Others

Oryzabase (2263)

KEGG (Os01t0884300-01)

Transcript

1526 bp

>Os01t0884300-01 No apical meristem (NAM) protein domain containing protein.
CAAGCCCTCCTCTCCTCTTCCCAACACTAGTAGGATAAAGCCACAGAGAGAGCAGTAGTA
GTAGCGAGCTCGCCGGAGAACGGACGATCACCGGagaagggggagagagatgagcggcgg
tcaggacctgcagctgccgccggggttccggttccacccgacggacgaggagctggtgat
gcactacctctgccgccgctgcgccggcctccccatcgccgtccccatcatcgccgagat
cgacctctacaagttcgatccatggcagcttccccGGATGGCGCTGTAcggagagaagga
gtggtacttcttctccccgcgagaccgcaagtacccgaacgggtcgcggccgaaccgcgc
cgccgggtcggggtactggaaggcgaccggcgccgacaagccggtgggctcgccgaagcc
ggtggcgatcaagaaggccctcgtcttctacgccggcaaggcgcccaagggcgagaagac
caactggatcatgcacgagtaccgcctCGCCGACGTCGACCGCTCCGCCCGCAAGAAGAA
CAGCCTCAGGTTGGATGATTGGGTGCTGTGCCGGATTTACAACAAGAAGGGCGGGCTGGA
GAAGCCGCCGGCCGCGGCGGTGGCGGCGGCGGGGATGGTGAGCAGCGGCGGCGGCGTCCA
GAGGAAGCCGATGGTGGGGGTGAACGCGGCGGTGAGCTCCCCGCCGGAGCAGAAGCCGGT
GGTGGCGGGGCCGGCGTTCCCGGACCTGGCGGCGTACTACGACCGGCCGTCGGACTCGAT
GCCGCGGCTGCACGCCGACTCGAGCTGCTCGGAGCAGGTGCTGTCGCCGGAGTTCGCGTG
CGAGGTGCAGAGCCAGCCCAAGATCAGCGAGTGGGAGCGCAccttcgccaccgtcgggcc
catcaaccccgccgcctccatcctcgaccccgccggctccggcggcctcggcggcctcgg
cggcggcggcagcgaccccctcctCCAGGACATCCTCATGTACTGGGGCAAGCCATTCTA
GACGACCAAAAAAAAAAAAAAACAACCGCATTGGCAGCAATGGTGTCACTGAACACCGTG
CAGGCTAGCTAGCTTCATGGCCGGTGAACTTTGACTCAGGCGAGCCGCCGGAGTTGACTC
AAAGATAATTAAAAGAAGTGTTTTAAGTGGATTGGATTGGATTAGACAGAGGAGATGAGG
ACTCGAGAAAGGCGGCGATGAGACCGTGGTTGGGGGGACCCTGGCCTGGACTGAACGACG
ACGAGGCAGCAGCAGAAAGATGGTGCAATTGCATCGGGTGGCATGTCAGTGTGTGTGTAT
AGTGGCATGTACATAGTACATGGTGATTGATTCGGTATACAGGGGGCTAGCTTTCCTGTT
TCTGTTTCTTCATTGGTTAATTATTACTCCCATTATAAGGTCTTCTTCAGGGTTGCTAGC
TTAATTAATTAATTAATTAGCCCAGTGGTTGAAGTGTAAGTCAAAATTCATCAAGTCAGA
GACTGGAATAATACAATACAGTACTG

CDS

912 bp

>Os01t0884300-01 No apical meristem (NAM) protein domain containing protein.
atgagcggcggtcaggacctgcagctgccgccggggttccggttccacccgacggacgag
gagctggtgatgcactacctctgccgccgctgcgccggcctccccatcgccgtccccatc
atcgccgagatcgacctctacaagttcgatccatggcagcttccccGGATGGCGCTGTAc
ggagagaaggagtggtacttcttctccccgcgagaccgcaagtacccgaacgggtcgcgg
ccgaaccgcgccgccgggtcggggtactggaaggcgaccggcgccgacaagccggtgggc
tcgccgaagccggtggcgatcaagaaggccctcgtcttctacgccggcaaggcgcccaag
ggcgagaagaccaactggatcatgcacgagtaccgcctCGCCGACGTCGACCGCTCCGCC
CGCAAGAAGAACAGCCTCAGGTTGGATGATTGGGTGCTGTGCCGGATTTACAACAAGAAG
GGCGGGCTGGAGAAGCCGCCGGCCGCGGCGGTGGCGGCGGCGGGGATGGTGAGCAGCGGC
GGCGGCGTCCAGAGGAAGCCGATGGTGGGGGTGAACGCGGCGGTGAGCTCCCCGCCGGAG
CAGAAGCCGGTGGTGGCGGGGCCGGCGTTCCCGGACCTGGCGGCGTACTACGACCGGCCG
TCGGACTCGATGCCGCGGCTGCACGCCGACTCGAGCTGCTCGGAGCAGGTGCTGTCGCCG
GAGTTCGCGTGCGAGGTGCAGAGCCAGCCCAAGATCAGCGAGTGGGAGCGCAccttcgcc
accgtcgggcccatcaaccccgccgcctccatcctcgaccccgccggctccggcggcctc
ggcggcctcggcggcggcggcagcgaccccctcctCCAGGACATCCTCATGTACTGGGGC
AAGCCATTCTAG

Protein

304 aa

>Os01t0884300-01 No apical meristem (NAM) protein domain containing protein.
MSGGQDLQLPPGFRFHPTDEELVMHYLCRRCAGLPIAVPIIAEIDLYKFDPWQLPRMALY
GEKEWYFFSPRDRKYPNGSRPNRAAGSGYWKATGADKPVGSPKPVAIKKALVFYAGKAPK
GEKTNWIMHEYRLADVDRSARKKNSLRLDDWVLCRIYNKKGGLEKPPAAAVAAAGMVSSG
GGVQRKPMVGVNAAVSSPPEQKPVVAGPAFPDLAAYYDRPSDSMPRLHADSSCSEQVLSP
EFACEVQSQPKISEWERTFATVGPINPAASILDPAGSGGLGGLGGGGSDPLLQDILMYWG
KPF*

5'UTR

chr01:38401373..38401481 (- strand) : 109 bp

CDS

chr01:38401207..38401372 (- strand) : 166 bp

chr01:38400833..38401107 (- strand) : 275 bp

chr01:38399501..38399971 (- strand) : 471 bp

3'UTR

chr01:38398996..38399500 (- strand) : 505 bp

FASTA

>Os01t0884300-01 class=Sequence position=chr01:38398996..38401481 (- strand)
CAAGCCCTCC TCTCCTCTTC CCAACACTAG TAGGATAAAG CCACAGAGAG AGCAGTAGTA GTAGCGAGCT CGCCGGAGAA
CGGACGATCA CCGGagaagg gggagagaga tgagcggcgg tcaggacctg cagctgccgc cggggttccg gttccacccg
acggacgagg agctggtgat gcactacctc tgccgccgct gcgccggcct ccccatcgcc gtccccatca tcgccgagat
cgacctctac aagttcgatc catggcagct tccccgtacg ataatcctcc tcCTCCATCC TCCCAATCAT CACCACCATC
AACGCCGTCG TGAATTGATT GATTGATTTG GTTTGATTTG TTGGTGTTGT GTAGGGATGG CGCTGTAcgg agagaaggag
tggtacttct tctccccgcg agaccgcaag tacccgaacg ggtcgcggcc gaaccgcgcc gccgggtcgg ggtactggaa
ggcgaccggc gccgacaagc cggtgggctc gccgaagccg gtggcgatca agaaggccct cgtcttctac gccggcaagg
cgcccaaggg cgagaagacc aactggatca tgcacgagta ccgcctCGCC GACGTCGACC GCTCCGCCCG CAAGAAGAAC
AGCCTCAGGG TAAGCAAAAA CCACACCCAA GATTCCATCA CTAAATTCAT TACTAAATCT GTGTTCATCG TGATTATTGA
TTAATTTAGT CACCTAATTA TTCGCCCAAA ACCGCAGCTC GATTCGAACA GCTGGTGGTA CTTCTAGATG GATACTACTA
TTTAGATATT TGATATATTT ATTTTGCAAC TTGTTTAATC AGCTCATTTC GCTTTCGAAA TGAATTGGGA GGATAAGCTT
AGCGTGGCCC ACGGCTTTGG GCCGCAGAAA TTAATTGGAG ACGTTGGCTC ATCTCATCTC TAGGGCCGCA CCTACGTGGT
GCAACTTGCG CAGCCACGAT CGAATCGTTC GAGCGTGAAA CCCATTGCCG TCACCACCTC GCCTCATCCC TTTCAGGGAC
CAATCGGTTT TTAGCCCTAC GCGCCCCTGC GATCGCGACG CCCACGATAG CTAAATCCCG AAAGCAAATA AGCAGTAATC
GGACAGCGAC TCGACCGGGA TTAGTTAAAC AATGGCTTGA TTAATTAGAT GCTGGAATTT GGAGCCTTCT GATAAGTtta
gggcctgttt ggcacagctc cagctccagc ttcacccctt ctggagctgg agctcagcca aacagtttcg gctccaccaa
aacggggagt ggagctgggt ggagctctct cacaaaatga actagagttg tggagttggg tttaggcagc tccacaactc
cactccagac tcaactcctg gagttaaatt taggagttgg agctgtacca aacaggccct taGTTTTGCA CTTGGTACTT
TAATTTTTTT TTGAGTGAGT GTAAATTTGT TTCTAAACTT TGTTTATGAA TTTGTTTTGT ATTGGTGCAG TTGGATGATT
GGGTGCTGTG CCGGATTTAC AACAAGAAGG GCGGGCTGGA GAAGCCGCCG GCCGCGGCGG TGGCGGCGGC GGGGATGGTG
AGCAGCGGCG GCGGCGTCCA GAGGAAGCCG ATGGTGGGGG TGAACGCGGC GGTGAGCTCC CCGCCGGAGC AGAAGCCGGT
GGTGGCGGGG CCGGCGTTCC CGGACCTGGC GGCGTACTAC GACCGGCCGT CGGACTCGAT GCCGCGGCTG CACGCCGACT
CGAGCTGCTC GGAGCAGGTG CTGTCGCCGG AGTTCGCGTG CGAGGTGCAG AGCCAGCCCA AGATCAGCGA GTGGGAGCGC
Accttcgcca ccgtcgggcc catcaacccc gccgcctcca tcctcgaccc cgccggctcc ggcggcctcg gcggcctcgg
cggcggcggc agcgaccccc tcctCCAGGA CATCCTCATG TACTGGGGCA AGCCATTCTA GACGACCAAA AAAAAAAAAA
AACAACCGCA TTGGCAGCAA TGGTGTCACT GAACACCGTG CAGGCTAGCT AGCTTCATGG CCGGTGAACT TTGACTCAGG
CGAGCCGCCG GAGTTGACTC AAAGATAATT AAAAGAAGTG TTTTAAGTGG ATTGGATTGG ATTAGACAGA GGAGATGAGG
ACTCGAGAAA GGCGGCGATG AGACCGTGGT TGGGGGGACC CTGGCCTGGA CTGAACGACG ACGAGGCAGC AGCAGAAAGA
TGGTGCAATT GCATCGGGTG GCATGTCAGT GTGTGTGTAT AGTGGCATGT ACATAGTACA TGGTGATTGA TTCGGTATAC
AGGGGGCTAG CTTTCCTGTT TCTGTTTCTT CATTGGTTAA TTATTACTCC CATTATAAGG TCTTCTTCAG GGTTGCTAGC
TTAATTAATT AATTAATTAG CCCAGTGGTT GAAGTGTAAG TCAAAATTCA TCAAGTCAGA GACTGGAATA ATACAATACA
GTACTG