Os01t0884400-01

Locus

Os01g0884400

Description

Armadillo domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PUB16

CGSNL Gene Name

PLANT U-BOX-CONTAINING PROTEIN 16

Oryzabase Gene Symbol Synonym(s)

OsPUB16

Oryzabase Gene Name Synonym(s)

plant U-box-containing protein 16, U-box protein 16

Transcript Evidence

AK072566 (DDBJ, Best hit)

Protein Evidence

B9EUZ0 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: protein ubiquitination (GO:0016567)

Cellular Component: ubiquitin ligase complex (GO:0000151)

Molecular Function: ubiquitin-protein ligase activity (GO:0004842)

Molecular Function: binding (GO:0005488)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

Armadillo (IPR000225)

U box domain (IPR003613)

Armadillo-like helical (IPR011989)

Zinc finger, RING/FYVE/PHD-type (IPR013083)

Armadillo-type fold (IPR016024)

Full-length cDNA

J023134O09 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0884400-01)

Others

Oryzabase (17808)

Transcript

2725 bp

>Os01t0884400-01 Armadillo domain containing protein.
GTCTTCGTCTCCGCCTCCTGCGACGAAGCGAAGCGAGACGCCTCCGCCTCGCGCGAGCCA
CCACGAGCACCTCGACACGGGAGTCCGAATCCTCCTCCTCCCCCCTCCATTGGAGGCCTC
CGAGGTGATGGATTCAGTGTCATTGTCACTACTCGATAGTATTTCAAATTTCCGGGTGCT
GTCTTCAAGCAATGCCTCGAAAACAGAGCTAGTTAAGAAATATTGCCAAACGATGGATGG
CATCCTTGATCACTTGGAGGTGGCCCTAAACAGAGCTTTTCCTCAGATTACTCCAGATGG
TGAACTAAGTAAAGTGCTTGAAGAACTTGGCGCTACCATCAATGAAGCGACTGAGCTAGT
TGGAGGCTGGAATCAAATGATGAGCAAGATTTATTTTGTTATTCAGGCTGATTCAATTAT
TGCCAAGATGCAGATATATGTATTCGAATTATGCCAAATTGTCAATTCTCTCATGCAGAT
TGAGTCAATGCATTTGGAGGATCTTGAACACGATAGCTGTGGAAAAATTTCAGATGTCAT
TAGGGAGGCTTCCAGGGCTTTAGCAGGGGAAGTTATGCCAAATTCAGAGGAATTTGGAAA
GATTCAAACTACTTTGAGCTTATCCACAAATCAGGAGTTGCTGATGGAATATGTTGCACT
TGTTAAGGTTAAAACAAAAGGTAATCATGAAGATAACAAAGAAATGGATGATATTAACGA
TATTGTTGAATTAGTCAACCATATGCTTGACAAACATGTGGAAGAAAAGCAAACACGTAG
CATTAATGGAGTGACCATTCCTGCTGATTTTTGTTGTCCTCTTTCCCTTGAACTAATGTC
GGATCCAGTGATTGTGGCATCTGGTCAAACGTATGAGCATGTTTTTATCAGAAAATGGTT
TGATCTGGGATACAACATTTGTCCAAAGACACGCCAAATATTGGGACACACCAAATTGAT
TCCTAACTTCACTGTCAAACAGTTGATTGAAAATTGGTGTGAGGTACATGGTATAATGCT
ACCAGATCCTGTTAAACTCTTGAGTTTGTGCTTCCCTGTTTCCCTCAACATCACAGATGG
AAGTGCAAGTGCAGACAAGTCTGGATCACCAGAACACTGCCAATTGGTAGCTGCATTGCA
TCCAAAAGCACAGTGCGCATCGGATGATAGTCATCATTATAATTTGATACATGAAAACTC
TGATTCAGATGATAGAGTGTCATCATTTGGAGACACAGATGATTCTGAACCTGATTCTTT
AAGATTATCAACAGAAACTACTGCAGCAAACAAATCTCTACTTGATGAAAAAACTGATCG
TTCTGATGGTCTTAAGCAATTGAGAGACAATGGTTTTCAAGTTTCTGATGAGGAACAGTA
TCTCGAAAGGAATGGTAAAAGTCATATCAGCAGCCATCATCAACTTGAAGTTGATGGAGA
GAATGTCAGGGTACAAGCATCAAGTGACATCAATGCATCTGAAGTTATGCAAGATGATCC
GGTCACCACATGTTCAAAGGTATCAGATAACCCTCCTAGATTGGGTGGTGTTCGTTCTCG
AAATCAGCCAAACTGGTGGAGACAGTCTAATAAAACTATTCCTAGGATCGGATTGTCATC
TTCGACAGATTCAAAACCAGATTTTTCTGGCAATGATGCTAAAGTGCGTAATCTTATCGA
GGAACTGAAAAGTGATTCTGCTGAGGTCCAAAGGTCAGCAACAGGAGAGCTCCGCATTCT
TTCTAGACACAGCTTGGAGAATAGAATTGCCATCGCAAACTGCGGAGCAATCCCCTTCTT
GGTGAGTCTACTTCATTCTACAGACCCCAGCACACAAGAAAATGCTGTGACAATTCTCCT
GAATTTGTCATTGGATGACAATAACAAGATTGCCATAGCAAGTGCTGAGGCCATTGAGCC
TCTCATCTTCGTTCTTCAGGTGGGAAACCCCGAAGCGAAAGCCAACTCAGCTGCAACTTT
ATTCAGCCTCTCAGTCATTGAAGAGAACAAGATCAAGATTGGACGTTCCGGTGCCATCGA
ACCATTAGTAGATTTACTGGGAGAAGGTACCCCGCAAGGGAAGAAGGATGCAGCTACTGC
ACTCTTCAATCTGTCGATATTTCATGAACACAAGACCCGCATTGTTCAGGCTGGGGCTGT
CAACCACCTGGTGGAGCTGATGGATCCAGCTGCTGGGATGGTTGATAAAGCTGTTGCTGT
TCTGGCAAACCTTGCGACTGTGCATGATGGAAGGAATGCCATTGCTCAGGCAGGAGGCAT
CCGAGTACTGGTTGAGGTTGTTGAGCTGGGTTCTGCACGTTCAAAGGAGAATGCCGCTGC
TGCCCTGCTACAACTCTGCACAAACAGTAACAGGTTTTGCACCCTGGTTCTTCAAGAAGG
CGTCGTGCCACCTTTGGTTGCATTGTCGCAATCAGGCACAGCCCGTGCAAGAGAGAAGGC
TCAGGTTCTTCTAAGCTATTTTCGCAACCAGCGCCACGTCAGGGTTGGGAGAGGGTAAGT
CTACGCAATTAAGCAGCAATGCGGCGGTCTGATTATTGTTCCATGATCCTTGTTGGCCGG
GCAATTAAGAGATGTATATTCCATCCTAGTCGTAGCATATTTTTTCTGGTAGTGATTCCA
AATGATTGATGTCACAAGTTGCTTCCTGTAAAGAAGACCCATCTATTGTGTATACATGGT
TTTCACGATATTTAGTTCACTTCTG

CDS

2517 bp

>Os01t0884400-01 Armadillo domain containing protein.
TCTTCGTCTCCGCCTCCTGCGACGAAGCGAAGCGAGACGCCTCCGCCTCGCGCGAGCCAC
CACGAGCACCTCGACACGGGAGTCCGAATCCTCCTCCTCCCCCCTCCATTGGAGGCCTCC
GAGGTGATGGATTCAGTGTCATTGTCACTACTCGATAGTATTTCAAATTTCCGGGTGCTG
TCTTCAAGCAATGCCTCGAAAACAGAGCTAGTTAAGAAATATTGCCAAACGATGGATGGC
ATCCTTGATCACTTGGAGGTGGCCCTAAACAGAGCTTTTCCTCAGATTACTCCAGATGGT
GAACTAAGTAAAGTGCTTGAAGAACTTGGCGCTACCATCAATGAAGCGACTGAGCTAGTT
GGAGGCTGGAATCAAATGATGAGCAAGATTTATTTTGTTATTCAGGCTGATTCAATTATT
GCCAAGATGCAGATATATGTATTCGAATTATGCCAAATTGTCAATTCTCTCATGCAGATT
GAGTCAATGCATTTGGAGGATCTTGAACACGATAGCTGTGGAAAAATTTCAGATGTCATT
AGGGAGGCTTCCAGGGCTTTAGCAGGGGAAGTTATGCCAAATTCAGAGGAATTTGGAAAG
ATTCAAACTACTTTGAGCTTATCCACAAATCAGGAGTTGCTGATGGAATATGTTGCACTT
GTTAAGGTTAAAACAAAAGGTAATCATGAAGATAACAAAGAAATGGATGATATTAACGAT
ATTGTTGAATTAGTCAACCATATGCTTGACAAACATGTGGAAGAAAAGCAAACACGTAGC
ATTAATGGAGTGACCATTCCTGCTGATTTTTGTTGTCCTCTTTCCCTTGAACTAATGTCG
GATCCAGTGATTGTGGCATCTGGTCAAACGTATGAGCATGTTTTTATCAGAAAATGGTTT
GATCTGGGATACAACATTTGTCCAAAGACACGCCAAATATTGGGACACACCAAATTGATT
CCTAACTTCACTGTCAAACAGTTGATTGAAAATTGGTGTGAGGTACATGGTATAATGCTA
CCAGATCCTGTTAAACTCTTGAGTTTGTGCTTCCCTGTTTCCCTCAACATCACAGATGGA
AGTGCAAGTGCAGACAAGTCTGGATCACCAGAACACTGCCAATTGGTAGCTGCATTGCAT
CCAAAAGCACAGTGCGCATCGGATGATAGTCATCATTATAATTTGATACATGAAAACTCT
GATTCAGATGATAGAGTGTCATCATTTGGAGACACAGATGATTCTGAACCTGATTCTTTA
AGATTATCAACAGAAACTACTGCAGCAAACAAATCTCTACTTGATGAAAAAACTGATCGT
TCTGATGGTCTTAAGCAATTGAGAGACAATGGTTTTCAAGTTTCTGATGAGGAACAGTAT
CTCGAAAGGAATGGTAAAAGTCATATCAGCAGCCATCATCAACTTGAAGTTGATGGAGAG
AATGTCAGGGTACAAGCATCAAGTGACATCAATGCATCTGAAGTTATGCAAGATGATCCG
GTCACCACATGTTCAAAGGTATCAGATAACCCTCCTAGATTGGGTGGTGTTCGTTCTCGA
AATCAGCCAAACTGGTGGAGACAGTCTAATAAAACTATTCCTAGGATCGGATTGTCATCT
TCGACAGATTCAAAACCAGATTTTTCTGGCAATGATGCTAAAGTGCGTAATCTTATCGAG
GAACTGAAAAGTGATTCTGCTGAGGTCCAAAGGTCAGCAACAGGAGAGCTCCGCATTCTT
TCTAGACACAGCTTGGAGAATAGAATTGCCATCGCAAACTGCGGAGCAATCCCCTTCTTG
GTGAGTCTACTTCATTCTACAGACCCCAGCACACAAGAAAATGCTGTGACAATTCTCCTG
AATTTGTCATTGGATGACAATAACAAGATTGCCATAGCAAGTGCTGAGGCCATTGAGCCT
CTCATCTTCGTTCTTCAGGTGGGAAACCCCGAAGCGAAAGCCAACTCAGCTGCAACTTTA
TTCAGCCTCTCAGTCATTGAAGAGAACAAGATCAAGATTGGACGTTCCGGTGCCATCGAA
CCATTAGTAGATTTACTGGGAGAAGGTACCCCGCAAGGGAAGAAGGATGCAGCTACTGCA
CTCTTCAATCTGTCGATATTTCATGAACACAAGACCCGCATTGTTCAGGCTGGGGCTGTC
AACCACCTGGTGGAGCTGATGGATCCAGCTGCTGGGATGGTTGATAAAGCTGTTGCTGTT
CTGGCAAACCTTGCGACTGTGCATGATGGAAGGAATGCCATTGCTCAGGCAGGAGGCATC
CGAGTACTGGTTGAGGTTGTTGAGCTGGGTTCTGCACGTTCAAAGGAGAATGCCGCTGCT
GCCCTGCTACAACTCTGCACAAACAGTAACAGGTTTTGCACCCTGGTTCTTCAAGAAGGC
GTCGTGCCACCTTTGGTTGCATTGTCGCAATCAGGCACAGCCCGTGCAAGAGAGAAGGCT
CAGGTTCTTCTAAGCTATTTTCGCAACCAGCGCCACGTCAGGGTTGGGAGAGGGTAA

Protein

839 aa

>Os01t0884400-01 Armadillo domain containing protein.
SSSPPPATKRSETPPPRASHHEHLDTGVRILLLPPPLEASEVMDSVSLSLLDSISNFRVL
SSSNASKTELVKKYCQTMDGILDHLEVALNRAFPQITPDGELSKVLEELGATINEATELV
GGWNQMMSKIYFVIQADSIIAKMQIYVFELCQIVNSLMQIESMHLEDLEHDSCGKISDVI
REASRALAGEVMPNSEEFGKIQTTLSLSTNQELLMEYVALVKVKTKGNHEDNKEMDDIND
IVELVNHMLDKHVEEKQTRSINGVTIPADFCCPLSLELMSDPVIVASGQTYEHVFIRKWF
DLGYNICPKTRQILGHTKLIPNFTVKQLIENWCEVHGIMLPDPVKLLSLCFPVSLNITDG
SASADKSGSPEHCQLVAALHPKAQCASDDSHHYNLIHENSDSDDRVSSFGDTDDSEPDSL
RLSTETTAANKSLLDEKTDRSDGLKQLRDNGFQVSDEEQYLERNGKSHISSHHQLEVDGE
NVRVQASSDINASEVMQDDPVTTCSKVSDNPPRLGGVRSRNQPNWWRQSNKTIPRIGLSS
STDSKPDFSGNDAKVRNLIEELKSDSAEVQRSATGELRILSRHSLENRIAIANCGAIPFL
VSLLHSTDPSTQENAVTILLNLSLDDNNKIAIASAEAIEPLIFVLQVGNPEAKANSAATL
FSLSVIEENKIKIGRSGAIEPLVDLLGEGTPQGKKDAATALFNLSIFHEHKTRIVQAGAV
NHLVELMDPAAGMVDKAVAVLANLATVHDGRNAIAQAGGIRVLVEVVELGSARSKENAAA
ALLQLCTNSNRFCTLVLQEGVVPPLVALSQSGTARAREKAQVLLSYFRNQRHVRVGRG*

5'UTR

chr01:38409242..38409242 (+ strand) : 1 bp

CDS

chr01:38409243..38409365 (+ strand) : 123 bp

chr01:38410135..38410407 (+ strand) : 273 bp

chr01:38410558..38410659 (+ strand) : 102 bp

chr01:38410746..38412704 (+ strand) : 1959 bp

chr01:38412791..38412850 (+ strand) : 60 bp

3'UTR

chr01:38412851..38413057 (+ strand) : 207 bp

FASTA

>Os01t0884400-01 class=Sequence position=chr01:38409242..38413057 (+ strand)
GTCTTCGTCT CCGCCTCCTG CGACGAAGCG AAGCGAGACG CCTCCGCCTC GCGCGAGCCA CCACGAGCAC CTCGACACGG
GAGTCCGAAT CCTCCTCCTC CCCCCTCCAT TGGAGGCCTC CGAGGTAACG GGGCTTCCTC TCCTGCTCTG GCTGCTGTTC
TGCTCTGTTC TGCGCGCGTG GTGTGATCGC GCTTGGTTAC CTTGCGGTGG GGGATCGAGG GAGAGGGTTG GGGGGGGGGG
GGGTGGGGGT GCTTCGTGCT GCATTTTGTG CTTGGATGGT GGAACTCGCC ATGGTTGGGT TTGGGAAGAT TTGAGCTTAG
TTCGGTGCGC TGGTGGTGGT GGATGTATGT GTGTACTGGA CGTGGTGATG GCGTTTGTTT GTGGTGGTGG GCAAGTACGG
CATGGGGTTT TCGAGATTTC TGTGCGGTTA GGGTTTGTGA TAGTGTGGGG ATAGTGCTTC GGTGCTTGTA TTGGGGCAAA
AATGCGTGTT CGGTGAGCTT GTTTGTATAC AGTTTGGACT AAGTAGTTCT GAATTTCTGA TGATCACCAA TTGTTTTACG
ACACTGACGA GATGTTTCGA TGCTATCACG CCTAAATTTG TTGCTTTCCG TTCCAGGTAT AAGCACGGAA TTTATGTCTA
TCTTAGTTCA CATATATAGT AGATAAATAA CAAGGCATGG TTAGTCATGC TTGGAAGTTA GCTAGCAGCT CATTTTCACT
GAAACGTGCA TGCTAACCTG CTTGTTATTA CTCAGCTATT TTTCTTACGC ATAACTTCGA ATGACAGTGG AATGCACCTG
CTTGTTTGTT TAGTCACTCT GAGCCTGTTT GAGCTTCCCC GTTCCTTTGT CTCCGCACCC GAAGTGAACT TAATTTTTGA
TTTGTTTATG TAGGTGATGG ATTCAGTGTC ATTGTCACTA CTCGATAGTA TTTCAAATTT CCGGGTGCTG TCTTCAAGCA
ATGCCTCGAA AACAGAGCTA GTTAAGAAAT ATTGCCAAAC GATGGATGGC ATCCTTGATC ACTTGGAGGT GGCCCTAAAC
AGAGCTTTTC CTCAGATTAC TCCAGATGGT GAACTAAGTA AAGTGCTTGA AGAACTTGGC GCTACCATCA ATGAAGCGAC
TGAGCTAGTT GGAGGCTGGA ATCAAATGAT GAGCAAGATT TATTTTGTAA CTACTTTGTC CTTTCCATGA TAAATCTCCC
TCATTAGTCA CTACATATAC AATGCTTTAA TTTCCATCCA AGTAGGATTT CCCCTATTAT TCTTCTTAAT ATGCTACTTA
GTAAATAACT CACTATGAGT AATATATTGG GTGCAGGTTA TTCAGGCTGA TTCAATTATT GCCAAGATGC AGATATATGT
ATTCGAATTA TGCCAAATTG TCAATTCTCT CATGCAGATT GAGTCAATGC ATTTGGAGGT GATAAAAAAA ATCCTTTCAC
ATCTTCTCAG TGACATTGTT TTGACATCTG ATTTTCTTAT CAGTGTGCTT CTTGCAACTT GCAGGATCTT GAACACGATA
GCTGTGGAAA AATTTCAGAT GTCATTAGGG AGGCTTCCAG GGCTTTAGCA GGGGAAGTTA TGCCAAATTC AGAGGAATTT
GGAAAGATTC AAACTACTTT GAGCTTATCC ACAAATCAGG AGTTGCTGAT GGAATATGTT GCACTTGTTA AGGTTAAAAC
AAAAGGTAAT CATGAAGATA ACAAAGAAAT GGATGATATT AACGATATTG TTGAATTAGT CAACCATATG CTTGACAAAC
ATGTGGAAGA AAAGCAAACA CGTAGCATTA ATGGAGTGAC CATTCCTGCT GATTTTTGTT GTCCTCTTTC CCTTGAACTA
ATGTCGGATC CAGTGATTGT GGCATCTGGT CAAACGTATG AGCATGTTTT TATCAGAAAA TGGTTTGATC TGGGATACAA
CATTTGTCCA AAGACACGCC AAATATTGGG ACACACCAAA TTGATTCCTA ACTTCACTGT CAAACAGTTG ATTGAAAATT
GGTGTGAGGT ACATGGTATA ATGCTACCAG ATCCTGTTAA ACTCTTGAGT TTGTGCTTCC CTGTTTCCCT CAACATCACA
GATGGAAGTG CAAGTGCAGA CAAGTCTGGA TCACCAGAAC ACTGCCAATT GGTAGCTGCA TTGCATCCAA AAGCACAGTG
CGCATCGGAT GATAGTCATC ATTATAATTT GATACATGAA AACTCTGATT CAGATGATAG AGTGTCATCA TTTGGAGACA
CAGATGATTC TGAACCTGAT TCTTTAAGAT TATCAACAGA AACTACTGCA GCAAACAAAT CTCTACTTGA TGAAAAAACT
GATCGTTCTG ATGGTCTTAA GCAATTGAGA GACAATGGTT TTCAAGTTTC TGATGAGGAA CAGTATCTCG AAAGGAATGG
TAAAAGTCAT ATCAGCAGCC ATCATCAACT TGAAGTTGAT GGAGAGAATG TCAGGGTACA AGCATCAAGT GACATCAATG
CATCTGAAGT TATGCAAGAT GATCCGGTCA CCACATGTTC AAAGGTATCA GATAACCCTC CTAGATTGGG TGGTGTTCGT
TCTCGAAATC AGCCAAACTG GTGGAGACAG TCTAATAAAA CTATTCCTAG GATCGGATTG TCATCTTCGA CAGATTCAAA
ACCAGATTTT TCTGGCAATG ATGCTAAAGT GCGTAATCTT ATCGAGGAAC TGAAAAGTGA TTCTGCTGAG GTCCAAAGGT
CAGCAACAGG AGAGCTCCGC ATTCTTTCTA GACACAGCTT GGAGAATAGA ATTGCCATCG CAAACTGCGG AGCAATCCCC
TTCTTGGTGA GTCTACTTCA TTCTACAGAC CCCAGCACAC AAGAAAATGC TGTGACAATT CTCCTGAATT TGTCATTGGA
TGACAATAAC AAGATTGCCA TAGCAAGTGC TGAGGCCATT GAGCCTCTCA TCTTCGTTCT TCAGGTGGGA AACCCCGAAG
CGAAAGCCAA CTCAGCTGCA ACTTTATTCA GCCTCTCAGT CATTGAAGAG AACAAGATCA AGATTGGACG TTCCGGTGCC
ATCGAACCAT TAGTAGATTT ACTGGGAGAA GGTACCCCGC AAGGGAAGAA GGATGCAGCT ACTGCACTCT TCAATCTGTC
GATATTTCAT GAACACAAGA CCCGCATTGT TCAGGCTGGG GCTGTCAACC ACCTGGTGGA GCTGATGGAT CCAGCTGCTG
GGATGGTTGA TAAAGCTGTT GCTGTTCTGG CAAACCTTGC GACTGTGCAT GATGGAAGGA ATGCCATTGC TCAGGCAGGA
GGCATCCGAG TACTGGTTGA GGTTGTTGAG CTGGGTTCTG CACGTTCAAA GGAGAATGCC GCTGCTGCCC TGCTACAACT
CTGCACAAAC AGTAACAGGT TTTGCACCCT GGTTCTTCAA GAAGGCGTCG TGCCACCTTT GGTTGCATTG TCGCAATCAG
GCACAGCCCG TGCAAGAGAG AAGGTTAGTA TTATAATCTT GTTTCCTAAA ACTGACAAGC TCATTTCTAT CCTAAAACTT
CCTTCAAACC TATACGTATT TATGCGCAGG CTCAGGTTCT TCTAAGCTAT TTTCGCAACC AGCGCCACGT CAGGGTTGGG
AGAGGGTAAG TCTACGCAAT TAAGCAGCAA TGCGGCGGTC TGATTATTGT TCCATGATCC TTGTTGGCCG GGCAATTAAG
AGATGTATAT TCCATCCTAG TCGTAGCATA TTTTTTCTGG TAGTGATTCC AAATGATTGA TGTCACAAGT TGCTTCCTGT
AAAGAAGACC CATCTATTGT GTATACATGG TTTTCACGAT ATTTAGTTCA CTTCTG

Locus: Os01g0884400

Loading...

Locus: Os01g0884400

Loading...