Os01t0886900-00

Locus

Os01g0886900

Description

Similar to EMB1879 (EMBRYO DEFECTIVE 1879).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RUS6A

CGSNL Gene Name

ROOT UV-B SENSITIVE 6A

Oryzabase Gene Symbol Synonym(s)

OsRUS6A

Oryzabase Gene Name Synonym(s)

Transcript Evidence

tplb0001d17 (Wheat FLcDNA)

Protein Evidence

NP_568713.1 (RefSeq)

Literature

Note

Manual Curation

Functional domain (InterPro)

Protein of unknown function DUF647 (IPR006968)

Expression Databases

TENOR (Os01t0886900-00)

Others

Oryzabase (21451)

KEGG (Os01t0886900-00)

Transcript

1917 bp

>Os01t0886900-00 Similar to EMB1879 (EMBRYO DEFECTIVE 1879).
ATGGGTGCGCGTAGCGAAGGAAAGCGCCTCCACTATAAAACGCTCCACCCTCTCTCTCTC
TCACCTCCATCTTGGCATTGCGTTCTCCGCCATATACAACTCTCTCTCTCTCTCTCCAAC
CACTGCGTCGTCTCGCATCGGTCGGTGTCGCGACCACCCGGTCGCCGCCGGTGGAGGTTT
CGGGTCGGCCACCTGACTAAGCCGCGGCCACGCAGGTCGCCGGCGCCGGTGCGCGCGGCA
GGGATGGCGCCGACGGTGGGGATCAAGcggtcggcggcggcggtggcgacgcagaccatc
agcgtgccgccgcccgacgcgcggttcgcggtgcgggaggccgtgcgggccaccatcgcg
tcgccgccggtcgaggcgccccccgccgccgccgggaaggcggcggcgccggcgcccgcg
gtggaggggttcctgtgcctggaggaggtggacgggaggcggtggagctacgtggtggat
gggggacaggggaaagggaaggggagggggagggggaggagcggcgcggCCGTTCCCATG
GGGGCCTCCGTTAGGGCCGTGCCGCTGCAGTCGCCGCTGCCGCCCGCCGAGGAAGTTATG
GCATTCATAAGATCATATGTTGTGCCTGAAGGCTTTCCGGATAGTGTTACTCCGTCATAC
GTCCCATACATGACCTGGAGAGCCCTGAAGCATTTCTTTGGTGGAGCTATGGGTGTTTTT
ACAACAAGAACCTTGCTGAGCTCTGTTGGAGTCTCTCAAAGCAAAGTAACACCAGGAGCC
ATTGCTATCAACTGGATCCTCAAGGATGGTGCAGGTCGTGTCGGAAAAATGCTTTTTGCA
CGTCAAGGAAAGAAGTTTGACTATGACCTAAAGCAGCTCCGCTTTTCTAGTGATCTATTG
CTGGAGATTGGAGCTGGAATTGAGTTAGCAACTGCAGCCTTTCCTCAATTTTTCTTGCCC
ATGGCTTGCGTAGCAAATGTTGTAAAGAATGTCGCGGCTGTTACATCAACATCAACTCGA
ACTCCAATTTATAAGGCCTATGCAAGAGGAGAAAACATTGGAGATGTCACTGCTAAAGGC
GAATCTGTTGGGAACATTGCAGATCTGCTGGGCACTGGCTTGAGCATCTTCATTTCAAAA
CGGAATCCATCATTGGTGACTTCATTTGCCTTCCTTTCATGTGGTTATCTTTGGAGTTCA
TATCATGAGGTGAGATCGGTCGTGCTAAATACTTTAAACAGAGCAAGGTTTACTGTTGCG
GTGGATTCCTTCATTAAAACTGGGCATATCCCCTCATTGAAGGAAGGGAACTCACAGGAG
ACGATATTTAATCCACCTTGGCGGCATGAGCCAGTTGCAATAGGATCACGATTTGGAGAA
GCGTTTCAAGAACCTGCTTCATTTGTTGCCATACGGCCATTGTTTGAGGATGAGAGATAC
ATGGTAACATATAACCCCGCAAAGGATAAGGTATATGCTTTGCTCAAGGATCAAGCAAAG
TCAGATGACATTATCAAAGCGGCTTTCCATGCTCATGTATTACTGCATTTCATCAATGCG
TCACATGCACGGAAGCAGATGAACTCCAGGAGATCAGATCCTTATGGAAACCCATGTAAC
ATGGATTTCATGGCACACATAGCTGAGTCCTGCAAAATTGTTTCTTCCTCTTATGGAACT
TTCAAGAAGAAAGCTAGAGAACAGGGTTGGATAATGTCAGAATCACTGCTCAACCCTGGG
AAAGCTCGGTTGTGTCCTGCAAGGCCATAATGATTTTACTGTTACTGGGATGGCAATATC
TTTCAGACTAACTTCTCAGCTAGACGGGATGCTCGGTTGTTTGTAGTAGCTGAACTGACA
AATGTTGGGCCCGAGCACCAAGTATGAACCAGTCATCCTGTCATGCCATGAAAACCC

CDS

1770 bp

>Os01t0886900-00 Similar to EMB1879 (EMBRYO DEFECTIVE 1879).
ATGGGTGCGCGTAGCGAAGGAAAGCGCCTCCACTATAAAACGCTCCACCCTCTCTCTCTC
TCACCTCCATCTTGGCATTGCGTTCTCCGCCATATACAACTCTCTCTCTCTCTCTCCAAC
CACTGCGTCGTCTCGCATCGGTCGGTGTCGCGACCACCCGGTCGCCGCCGGTGGAGGTTT
CGGGTCGGCCACCTGACTAAGCCGCGGCCACGCAGGTCGCCGGCGCCGGTGCGCGCGGCA
GGGATGGCGCCGACGGTGGGGATCAAGcggtcggcggcggcggtggcgacgcagaccatc
agcgtgccgccgcccgacgcgcggttcgcggtgcgggaggccgtgcgggccaccatcgcg
tcgccgccggtcgaggcgccccccgccgccgccgggaaggcggcggcgccggcgcccgcg
gtggaggggttcctgtgcctggaggaggtggacgggaggcggtggagctacgtggtggat
gggggacaggggaaagggaaggggagggggagggggaggagcggcgcggCCGTTCCCATG
GGGGCCTCCGTTAGGGCCGTGCCGCTGCAGTCGCCGCTGCCGCCCGCCGAGGAAGTTATG
GCATTCATAAGATCATATGTTGTGCCTGAAGGCTTTCCGGATAGTGTTACTCCGTCATAC
GTCCCATACATGACCTGGAGAGCCCTGAAGCATTTCTTTGGTGGAGCTATGGGTGTTTTT
ACAACAAGAACCTTGCTGAGCTCTGTTGGAGTCTCTCAAAGCAAAGTAACACCAGGAGCC
ATTGCTATCAACTGGATCCTCAAGGATGGTGCAGGTCGTGTCGGAAAAATGCTTTTTGCA
CGTCAAGGAAAGAAGTTTGACTATGACCTAAAGCAGCTCCGCTTTTCTAGTGATCTATTG
CTGGAGATTGGAGCTGGAATTGAGTTAGCAACTGCAGCCTTTCCTCAATTTTTCTTGCCC
ATGGCTTGCGTAGCAAATGTTGTAAAGAATGTCGCGGCTGTTACATCAACATCAACTCGA
ACTCCAATTTATAAGGCCTATGCAAGAGGAGAAAACATTGGAGATGTCACTGCTAAAGGC
GAATCTGTTGGGAACATTGCAGATCTGCTGGGCACTGGCTTGAGCATCTTCATTTCAAAA
CGGAATCCATCATTGGTGACTTCATTTGCCTTCCTTTCATGTGGTTATCTTTGGAGTTCA
TATCATGAGGTGAGATCGGTCGTGCTAAATACTTTAAACAGAGCAAGGTTTACTGTTGCG
GTGGATTCCTTCATTAAAACTGGGCATATCCCCTCATTGAAGGAAGGGAACTCACAGGAG
ACGATATTTAATCCACCTTGGCGGCATGAGCCAGTTGCAATAGGATCACGATTTGGAGAA
GCGTTTCAAGAACCTGCTTCATTTGTTGCCATACGGCCATTGTTTGAGGATGAGAGATAC
ATGGTAACATATAACCCCGCAAAGGATAAGGTATATGCTTTGCTCAAGGATCAAGCAAAG
TCAGATGACATTATCAAAGCGGCTTTCCATGCTCATGTATTACTGCATTTCATCAATGCG
TCACATGCACGGAAGCAGATGAACTCCAGGAGATCAGATCCTTATGGAAACCCATGTAAC
ATGGATTTCATGGCACACATAGCTGAGTCCTGCAAAATTGTTTCTTCCTCTTATGGAACT
TTCAAGAAGAAAGCTAGAGAACAGGGTTGGATAATGTCAGAATCACTGCTCAACCCTGGG
AAAGCTCGGTTGTGTCCTGCAAGGCCATAA

Protein

590 aa

>Os01t0886900-00 Similar to EMB1879 (EMBRYO DEFECTIVE 1879).
MGARSEGKRLHYKTLHPLSLSPPSWHCVLRHIQLSLSLSNHCVVSHRSVSRPPGRRRWRF
RVGHLTKPRPRRSPAPVRAAGMAPTVGIKRSAAAVATQTISVPPPDARFAVREAVRATIA
SPPVEAPPAAAGKAAAPAPAVEGFLCLEEVDGRRWSYVVDGGQGKGKGRGRGRSGAAVPM
GASVRAVPLQSPLPPAEEVMAFIRSYVVPEGFPDSVTPSYVPYMTWRALKHFFGGAMGVF
TTRTLLSSVGVSQSKVTPGAIAINWILKDGAGRVGKMLFARQGKKFDYDLKQLRFSSDLL
LEIGAGIELATAAFPQFFLPMACVANVVKNVAAVTSTSTRTPIYKAYARGENIGDVTAKG
ESVGNIADLLGTGLSIFISKRNPSLVTSFAFLSCGYLWSSYHEVRSVVLNTLNRARFTVA
VDSFIKTGHIPSLKEGNSQETIFNPPWRHEPVAIGSRFGEAFQEPASFVAIRPLFEDERY
MVTYNPAKDKVYALLKDQAKSDDIIKAAFHAHVLLHFINASHARKQMNSRRSDPYGNPCN
MDFMAHIAESCKIVSSSYGTFKKKAREQGWIMSESLLNPGKARLCPARP*

CDS

chr01:38534739..38535329 (+ strand) : 591 bp

chr01:38536364..38536462 (+ strand) : 99 bp

chr01:38536555..38536668 (+ strand) : 114 bp

chr01:38537090..38537161 (+ strand) : 72 bp

chr01:38537261..38537371 (+ strand) : 111 bp

chr01:38537479..38537598 (+ strand) : 120 bp

chr01:38538089..38538190 (+ strand) : 102 bp

chr01:38538282..38538354 (+ strand) : 73 bp

chr01:38538738..38538818 (+ strand) : 81 bp

chr01:38538908..38538972 (+ strand) : 65 bp

chr01:38539124..38539225 (+ strand) : 102 bp

chr01:38539312..38539485 (+ strand) : 174 bp

chr01:38539614..38539679 (+ strand) : 66 bp

3'UTR

chr01:38539680..38539826 (+ strand) : 147 bp

FASTA

>Os01t0886900-00 class=Sequence position=chr01:38534739..38539826 (+ strand)
ATGGGTGCGC GTAGCGAAGG AAAGCGCCTC CACTATAAAA CGCTCCACCC TCTCTCTCTC TCACCTCCAT CTTGGCATTG
CGTTCTCCGC CATATACAAC TCTCTCTCTC TCTCTCCAAC CACTGCGTCG TCTCGCATCG GTCGGTGTCG CGACCACCCG
GTCGCCGCCG GTGGAGGTTT CGGGTCGGCC ACCTGACTAA GCCGCGGCCA CGCAGGTCGC CGGCGCCGGT GCGCGCGGCA
GGGATGGCGC CGACGGTGGG GATCAAGcgg tcggcggcgg cggtggcgac gcagaccatc agcgtgccgc cgcccgacgc
gcggttcgcg gtgcgggagg ccgtgcgggc caccatcgcg tcgccgccgg tcgaggcgcc ccccgccgcc gccgggaagg
cggcggcgcc ggcgcccgcg gtggaggggt tcctgtgcct ggaggaggtg gacgggaggc ggtggagcta cgtggtggat
gggggacagg ggaaagggaa ggggaggggg agggggagga gcggcgcggC CGTTCCCATG GGGGCCTCCG TTAGGGCCGT
GCCGCTGCAG TCGCCGCTGC CGCCCGCCGA GGTGAGCTTG CTGTGAATTG TACACATGCT GCCATGTTCT CTGCTGATTA
CTGTTTGTCC AATGGCTCTG CGCTGTGGGT TCGATTTAGG GTGATTAGCT GCGGATTTTG AGCGATTCGA TGGTTCGAAT
TGGTCTATGT TGTTGGTTGG ATACTTAGAT TTGTTGACTC GGAGGATTAG GCATCTGCAG ATTTGATTTT GGGGTATTGA
TCCAATAGGG ACCTATTTTG CTGCGGATAT TTGGTTTTTT CCCTCAGGAT GTGGGGGCTC GCTGATTTTG ACCTTCTCCG
GCACATTTGA GTTAAGTGAT TCGATATTTT CGAGGTAATT GGAGGTGAAA CTGGGGGAGG TAGGACGGCA TCGGGGCTTC
CGGGTTTACA GTTAGCTTCG TAGTAAGTTT GTCGTATGCT TCTTTATCGC ATTAATTTCT AGTTAGTTCG AACATATTTG
TTCAAAATTT AGGCCTCTTT TGCTCGGGAG ATTTTTTTTC TTGACTAAGG GTCTTTCTGT TTAATACGCG GAAGTTCCAA
CCTTTAGTTT GTCGATTCTC TACGTTTATT TCAAAGCATA GTCTCGGGAT AGAAGGATTG ATTTGCTGTT GAACTTTTGT
CCAAAGTCTT TAACTACGAG TAGTATTATA TAGTGTTTTC TCTTTTAACA TTTTGATTTT CTATTATTGT TGAAGATGTC
AGGTGCCGTG TGAAAAAAGC TGATATCGgt acctatttcc tccgtcccat aatataaggg attttgagtt tttgattgca
acgtttgact actcgtctta ttcaattttt tttttgcaaa tataaaaaac gaaaagttgt gcttaaagta ctgtagataa
taaaataagt cataaataaa ataaataatg attttaaaaa attttgaata agacgagtgg tcaaacgttg caagcaaaaa
ctcaaaatcc cttatattat gggacggagg gagtaATAAA TAATCTACAG TCACCATATA CAGCTTGAAA ATAATAAATA
ACCAAGCAAA ATAATATGGC TGCAGGAAGT TATGGCATTC ATAAGATCAT ATGTTGTGCC TGAAGGCTTT CCGGATAGTG
TTACTCCGTC ATACGTCCCA TACATGACCT GGAGAGCCCT GAAGGTATAT TTCGGAACTT GTGTTCACTT GTCGTTTGTG
ACTTCTGAAT CAAATACATC ATGCTAACTT AAAATTATTA TTTTTGTATC CCTTAGCATT TCTTTGGTGG AGCTATGGGT
GTTTTTACAA CAAGAACCTT GCTGAGCTCT GTTGGAGTCT CTCAAAGCAA AGTAACACCA GGAGCCATTG CTATCAACTG
GATCCTCAAG GTAAATAATT ATGTCTATTC AAGAGGATAT TTTTTCTGGT CACCATGCTT GTGTAATTTA TTGAAGTCTT
CTGAGAACCG GGGAAATTCG TGCAATGAAG GACTCAGTCA ATCCATTACC ACTGGCATGA ACACAAAACA AGTGGAAATC
AATGAGTATA TGCTAAAATA ATCTTGTTTA TGATCGCTAA TTCCTTTCCA ATGAAGTAAT TGTTGATGTA TAATAGCTTC
ATAAGTTGCC CACACCACAA CGACCCGAAG AGTCTTATTC TTCTAGTATT TTTGGCTATC CAATCTGCAC AACCAAATAG
CAATACCCTG TTTTCCTGTT GATTATATTT TCTTCTTATC CTTAGCAACA AAGTAGGCAT TTTAATCTAC CTTGTAATAT
AATATGAGTT CTTGTTATGC TATTGCTTCA GGATGGTGCA GGTCGTGTCG GAAAAATGCT TTTTGCACGT CAAGGAAAGA
AGTTTGACTA TGACCTAAAG CAGGTAAATC ATATGGAAGC AAGTCCATTT ATGCAATATT CACATTATTC ACAATTTCTT
TGTCCCATGT ACACAACTGA CTGAGGCTGA AAATTTCTGC AGCTCCGCTT TTCTAGTGAT CTATTGCTGG AGATTGGAGC
TGGAATTGAG TTAGCAACTG CAGCCTTTCC TCAATTTTTC TTGCCCATGG CTTGCGTAGC AAATGTTGTA AAGGTCTGTC
CTCACCAGCT GTTGCAAACC ACACATATTG GACTTAAAAT ATATCTATCT GTTTCAAAAA GTATTGATGA AGAGCGTTCT
TTCTTTCTGC AATGTTCTAG AATGTCGCGG CTGTTACATC AACATCAACT CGAACTCCAA TTTATAAGGC CTATGCAAGA
GGAGAAAACA TTGGAGATGT CACTGCTAAA GGCGAATCTG TTGGGAACAT TGCAGATCTG GTAATTATTA ATCTGTTGAG
CTTTCTTGTT ACTAAGTGGC TTGTCAATAC CAAGGCTTCC TAATGCTGCT ATAAATGATT GTTGCAACCT ACTGATTTCT
ATGCAAAAAC ATTGTCCATG TTTTTGGCCC CTCCAAGCAT GCCCATTGTG CATATAGCCT ATAGTTGTAG ATGTTTTGTT
ACACTGAATG GAAGTGTAAT TTGCAATTTT TGTACGAAAT CTACAGTATG GAGAACTAGT TGTGTTTGTC TACCTCACAC
TATATGTTCT TCTGTGTCTG CCCTGTTACC TGCAATTGTA CATGCAGCTG AAAGTTCTGC TTCGATAGCA TAAGTTACCC
GCAAGTATCT TTTATTTGAT GCCACTGCAT GGCAATACAC ATACAGAACA AGCAGAATGT TTTTTAACTC ACTTTGGAAT
GTTACTAGTC TCATACTACT ATACTTAATT CAGCAGTTAT CCTGACTTTG CCTTGTTATT TTAAATGAAG CTGGGCACTG
GCTTGAGCAT CTTCATTTCA AAACGGAATC CATCATTGGT GACTTCATTT GCCTTCCTTT CATGTGGTTA TCTTTGGAGT
TCATATCATG AGGTTCGCAT TCATTCTTTC AAGTTATTGT TTCAGTGCTT TCTTGAACTC TGGAAGATTT TATAACATAT
GTTGGTTCCA TTCCTTTTAC CAGGTGAGAT CGGTCGTGCT AAATACTTTA AACAGAGCAA GGTTTACTGT TGCGGTGGAT
TCCTTCATTA AAACTGGTGA GTCTAAAACT TCTCTTTTGG TTGTTGTGGG AAGTGCGACA TTGATCCTTA ATTGTTTATT
GAGTCAATGA AGCAGTGCCT TTCTGTGGGA CAATACAAAC AATCTTCCAA ATGATATTTA CATAATCATA TTCATATGGC
ACACCACAGT ATAAAATTTC TTTTGGTCAA ATACATGAGA CTGCTATGAA GTATGGACAT AAGTTTTTTT CATATCTAGC
GTGGTGGCCC ACTATCATCT AAGAAAAATA AGTCTTCAAA TGCTGAGCTT GAAACTGAAT CTGGTCCTTT TCATATAAAA
TTAAATAGGT GTCCTGTTTA GGCACTTTGC TTTTATTCTA TTCTGTCAAA TACTTAATAT CTAATTCTCT GTGGTCCAGG
GCATATCCCC TCATTGAAGG AAGGGAACTC ACAGGAGACG ATATTTAATC CACCTTGGCG GCATGAGCCA GTTGCAATAG
GTTTGTACCA GTGCTTCTGA TTGCAATCAT TCTTGAATTC TGATACATAT TGGATGGCAT TTCATTGTCC ATGCATAACT
AATTTTCAGG ATCACGATTT GGAGAAGCGT TTCAAGAACC TGCTTCATTT GTTGCCATAC GGCCATTGTT TGAGGTACAT
CCTTAGTTCC TTGACCACCA GCACATAAAC ACAAACCCAC AGAAGACATT GCATTTTCTG TTTCCCTCTT AAAGAGTGTC
ATTTCATTCA CTGGTCGGCT ATATCTGGGC ATATGAAATA TTTCCTTCAT ATATCTAACT TACAGGATGA GAGATACATG
GTAACATATA ACCCCGCAAA GGATAAGGTA TATGCTTTGC TCAAGGATCA AGCAAAGTCA GATGACATTA TCAAAGCGGC
TTTCCATGTA AGCACCTGTC CTCACTGCAT TAAGGGTTTT TTGGCCCCGT TTATTGTTTA TCCTTTATTC TAACATGGCG
TTCTGCTGTA CAGGCTCATG TATTACTGCA TTTCATCAAT GCGTCACATG CACGGAAGCA GATGAACTCC AGGAGATCAG
ATCCTTATGG AAACCCATGT AACATGGATT TCATGGCACA CATAGCTGAG TCCTGCAAAA TTGTTTCTTC CTCTTATGGA
ACTTTCAAGA AGAAAGCTAG AGAACAGGTA CTATTCCTTG TCTTTGTGAT AAATACTGAC CCTTGCATCC CAACTACTAG
ATATAATTGT GGATAAGCCA CTTGAATGAA ACGGTTGCTG CATGACTTAA CAACATCCTC TTTTCTGTAC CTCAGGGTTG
GATAATGTCA GAATCACTGC TCAACCCTGG GAAAGCTCGG TTGTGTCCTG CAAGGCCATA ATGATTTTAC TGTTACTGGG
ATGGCAATAT CTTTCAGACT AACTTCTCAG CTAGACGGGA TGCTCGGTTG TTTGTAGTAG CTGAACTGAC AAATGTTGGG
CCCGAGCACC AAGTATGAAC CAGTCATCCT GTCATGCCAT GAAAACCC

Locus: Os01g0886900

Loading...

Locus: Os01g0886900

Loading...