Os01t0897700-01

Locus

Os01g0897700

Description

Putative type I Formin, Regulation of root-hair elongation

RAP-DB Gene Symbol Synonym(s)

OsFH1

RAP-DB Gene Name Synonym(s)

Formin homology 1

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsFH1, FH1

Oryzabase Gene Name Synonym(s)

Formin homology 1, type I Formin, forming family protein 1, FH2 protein 1, FH2 domain protein 1

Transcript Evidence

AK061290 (truncated)

Inferred from literature

Protein Evidence

Q8S0F0

Literature

PMID: 23334469

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

July 30, 2020

Functional domain (InterPro)

Formin, FH2 domain superfamily (IPR042201)

Formin, FH2 domain (IPR015425)

Experimentally confirmed subcellular location

plasma membrane (GO:0005886)

Full-length cDNA

006-301-A05(truncated) (Online Clone Ordering)

Expression Databases

TENOR (Os01t0897700-01)

RiceXPro (AK061290)

Others

Oryzabase (12268)

KEGG (Os01t0897700-01)

Transcript

3356 bp

>Os01t0897700-01 Putative type I Formin, Regulation of root-hair elongation
AAGCTGTATCCACCACGACGACGTCCACTCCTCTTCTTCCTCCTCTCCTCCTCTCTCTCT
CTTCTTTCTCTCTCCTCGCGAGATCTGTGGCGTCACTGACCTAGCTTGTTCTTGCTAGCT
GCTGCTGCTGCTTCGGCGGTGGCGGTGTGTGTGGCAATGCCGTCTCTCCGGCGATTCTTG
GAGTTGGTGGTGGTTGGGATTGTTGTGTGTGGTGTCAATGGCGGGAGTGATGGTTTGGAG
GTTGCGGTGGCGAGGAGGCAGCTGCACCAGCCGTTCTTCCCGGATCAGTCGTCGTCGCCG
CCGACGCCGGCGCCGCCCGGCCCCGCTCCGCCGTTCTTCCCGGCGCTGCCGGTGCCGCCG
CCGCCGCCGGCGACGGCGGGGCAGGAGCAGCCGACGTACCCCGCCCTCGTGCTGCCCAAC
ACCGGCGCCGGTGGCGCGGCGGCGACGGCCGCTCCGGATGGAGGTGGTGGTGGTGGTGGT
GGGGCGAGGAAGTCGAAGAGCAGCGCGTCGAAGCTTGTCCCGGCGATTGTGCTGCCGCTG
CTCACGGTGGCCGTGCTCGGGCTGTCCATCGCGTTCTTCTTCACGCACCGGCGTGGGAAT
GCGGCGCGCGGGGGAGGAGGAGGCGGCGGGTGCGTCGGTGGCGGGGACGCCAAGTTCTTG
CACCCGGAGAGGGCGAGCCTCTTCGCGCGCGACGAGTTCGGCGGGAGCGGCGGCGCCGCC
GCGCCGCCGGCCGCGGCGATGGATTACCGCTACGTGGGGAACGCCGGCATCGGGCGGATG
GACGAGAAGAGCAGCGAGACGACGTCGTCGGGCGACGAGGCGTCCCGGAGCACCGGCGGA
TCGCCGGAGCTCCGCCCGCTGCCGCCGCTGCTGGCGCGGCAATGCGGGCCGATGGGCGCG
AGGAGCCCCGGCAGCGGCGTCGGCGGGTTCGCGTCGCCGTCGTCCGGCGACGAGGAATTC
TACTCGCCGCAAGGATCATCCAAGATGTCGACCTCGCACAGAACGCTCGCCGCCGCGGTC
GAAGCCGCTGTGGCCGCGCGCGACCGCTCCAAGAGCCCCTCGCCCGGCTCGATCGTGAGC
ACGCCGTCGTACCCGTCCTCGCCCGGCGCGACGATGTCCCCGGCGCCCGCCTCGCCGCCT
CTCTTCTCCAGCCCCGGCCAGTCGGGCCGCCGCTCCGTCAAGTCAAGATCCGATAGCGTG
CGCACCTTCGGCCAACCACCGGCGCCTCCAccaccacctcccttcgcgccgacgctgcca
ccgccgcctccgcctcgccggaaaccgccgtcgccatcaccgccctcctccccactcatc
gagaacacgtcggcgctcagatccaccaccaccaccgacaccaccatcccaagaaaccca
ttcgtacaaccaccacccccaccgacacacacccacggaccaccaccgccgccgccgccg
ccgcctccgccgccggtgggctactgggagagccgcgtgcggaagcctggcaccggaacg
tccaaagaaacccggtccccggcgctgtcgccgccgccgcaggccgccagcttcAAGAGC
GGTCTACCCACCGACGCGTTCCCCGGCCGCCTCGCGGACAATGCGGACCACGCCGCCGCC
GCCGCGGCCGGCGGCGGCGGCGACAAGTCGGAGGAGACGACGCCGCGGCCGAAGCTGAAG
CCGCTGCACTGGGACAAGGTCCGGGCAAGCTCCGACCGCGTCATGGTGTGGGATCAGCTC
AAATCCAGCTCGTTCCAGGTGAATGAGGAGATGATCGAGACATTGTTCATCTGCAATCCG
GCGAACTCGGCGCCACCGAAGGAGCCAGCAACGAGGAGGCCGGTGCTGCCGACGCCCAAG
ACGGACAACAAGGTGCTTGATCCAAAGAAGTCGCAGAACATCGCCATCTTGCTGCGAGCT
CTGAATGTATCCAAGGAGCAGGTCTGCGACGCGCTCTGCGAAGGTAACACAGAGAACTTT
GGAGCAGAATTGTTGGAGACCTTGCTAAAGATGGCTCCTACCAAGGAAGAGGAGATCAAA
TTGAGAGAATTCAAAGAGGAGACATCTCCTATTAAGCTTGGTCCTGCTGAGAAATTCCTT
AAGGCAGTCCTTGATATCCCATTTGCTTTCAAAAGAGTAGACGCAATGCTTTACATTGCT
AACTTTGAATCAGAGGTTAATTACCTGAAGAAGTCCTTTGAGACCCTTGAGACTGCTTGT
GACGAGCTTAGAAACAGCAGGCTGTTTCTGAAGCTACTTGAAGCTGTCCTGAAGACTGGC
AACAGGATGAATGTTGGAACAAATCGCGGCGATGCACACGCGTTCAAGCTTGATACTCTA
CTCAAATTGGTTGATGTCAAAGGCACTGATGGCAAGACTACACTTTTGCATTTTGTCGTG
CAGGAGATTATCCGAACGGAGGGCTCCCACCTCTCTGCTAGCAACCAATCAACTCCACGA
ACTCAGGCAAACCCTTTACGGGACGAGCTCGAGTGCAAAAAGCTTGGCCTCCAGGTAGTG
GCTGGCCTCGGAAACGAGCTCAGCAATGTCAAGAAGGCAGCTGCCATGGACTCCGACGTG
CTAAGCAGCTATGTCTCGAAACTTGCTGGAGGAATAGAGAAGATCACTGAGGTGTTGCGG
TTGAATGAAGAAGTCAAGTCCAGGGAAGATGCATGGAGGTTCCATGATTCAATGCAGAAG
TTCTTGAAGAGGGCTGATGACGACATCATCAGGGTTCAGGCTCAGGAGAGCGTTGCGCTA
TCACTTGTGAAGGAGATCACCGAGTACTTCCATGGTGACTCTGCGAAAGAGGAAGCTCAC
CCTTTCAGGATCTTCATGGTGGTCAGGGATTTCCTCTCAGTTCTTGATCAAGTCTGCAAG
GAAGTTGGCAGGATCAATGACCGCACGATCGCTAGCTCGGTGCGCCATTTCCCAGTACCC
GTCAACCCAATGATGCCACAGTTGTTCCCCAGGATTCATGCTTTGAGAGCTGGAATCTCA
GATGATGAAAGTTCAGCCACTTCAGCATCATCACCTTGATCACCAGTAGTCTGCCAATAG
AAATTTTTCGCAGAGTACTGTGGGAAACCTCCATAGGGCAGAGGGAGACCAACGGCGACG
GGGTGTCAAATTTTTTTTTGAACCTTTTGTACCTGTAGATTATAGAATGTAAGAAGTTTT
TTTGCAAATATTTATTTCTATATATAAGAGGAGATAAAATCTAGATCAGAGGAGGAAATA
AGCAGTTCATGTGTTTGTCATCTTCAGTCTGTACATGACACGAGGTAGTGAAACAGCCTG
TACAATGTACTAACAATTTCAAGTATGGCCAGTCTGCAGAATTCAAAGGTAAGCTG

CDS

2883 bp

>Os01t0897700-01 Putative type I Formin, Regulation of root-hair elongation
ATGCCGTCTCTCCGGCGATTCTTGGAGTTGGTGGTGGTTGGGATTGTTGTGTGTGGTGTC
AATGGCGGGAGTGATGGTTTGGAGGTTGCGGTGGCGAGGAGGCAGCTGCACCAGCCGTTC
TTCCCGGATCAGTCGTCGTCGCCGCCGACGCCGGCGCCGCCCGGCCCCGCTCCGCCGTTC
TTCCCGGCGCTGCCGGTGCCGCCGCCGCCGCCGGCGACGGCGGGGCAGGAGCAGCCGACG
TACCCCGCCCTCGTGCTGCCCAACACCGGCGCCGGTGGCGCGGCGGCGACGGCCGCTCCG
GATGGAGGTGGTGGTGGTGGTGGTGGGGCGAGGAAGTCGAAGAGCAGCGCGTCGAAGCTT
GTCCCGGCGATTGTGCTGCCGCTGCTCACGGTGGCCGTGCTCGGGCTGTCCATCGCGTTC
TTCTTCACGCACCGGCGTGGGAATGCGGCGCGCGGGGGAGGAGGAGGCGGCGGGTGCGTC
GGTGGCGGGGACGCCAAGTTCTTGCACCCGGAGAGGGCGAGCCTCTTCGCGCGCGACGAG
TTCGGCGGGAGCGGCGGCGCCGCCGCGCCGCCGGCCGCGGCGATGGATTACCGCTACGTG
GGGAACGCCGGCATCGGGCGGATGGACGAGAAGAGCAGCGAGACGACGTCGTCGGGCGAC
GAGGCGTCCCGGAGCACCGGCGGATCGCCGGAGCTCCGCCCGCTGCCGCCGCTGCTGGCG
CGGCAATGCGGGCCGATGGGCGCGAGGAGCCCCGGCAGCGGCGTCGGCGGGTTCGCGTCG
CCGTCGTCCGGCGACGAGGAATTCTACTCGCCGCAAGGATCATCCAAGATGTCGACCTCG
CACAGAACGCTCGCCGCCGCGGTCGAAGCCGCTGTGGCCGCGCGCGACCGCTCCAAGAGC
CCCTCGCCCGGCTCGATCGTGAGCACGCCGTCGTACCCGTCCTCGCCCGGCGCGACGATG
TCCCCGGCGCCCGCCTCGCCGCCTCTCTTCTCCAGCCCCGGCCAGTCGGGCCGCCGCTCC
GTCAAGTCAAGATCCGATAGCGTGCGCACCTTCGGCCAACCACCGGCGCCTCCAccacca
cctcccttcgcgccgacgctgccaccgccgcctccgcctcgccggaaaccgccgtcgcca
tcaccgccctcctccccactcatcgagaacacgtcggcgctcagatccaccaccaccacc
gacaccaccatcccaagaaacccattcgtacaaccaccacccccaccgacacacacccac
ggaccaccaccgccgccgccgccgccgcctccgccgccggtgggctactgggagagccgc
gtgcggaagcctggcaccggaacgtccaaagaaacccggtccccggcgctgtcgccgccg
ccgcaggccgccagcttcAAGAGCGGTCTACCCACCGACGCGTTCCCCGGCCGCCTCGCG
GACAATGCGGACCACGCCGCCGCCGCCGCGGCCGGCGGCGGCGGCGACAAGTCGGAGGAG
ACGACGCCGCGGCCGAAGCTGAAGCCGCTGCACTGGGACAAGGTCCGGGCAAGCTCCGAC
CGCGTCATGGTGTGGGATCAGCTCAAATCCAGCTCGTTCCAGGTGAATGAGGAGATGATC
GAGACATTGTTCATCTGCAATCCGGCGAACTCGGCGCCACCGAAGGAGCCAGCAACGAGG
AGGCCGGTGCTGCCGACGCCCAAGACGGACAACAAGGTGCTTGATCCAAAGAAGTCGCAG
AACATCGCCATCTTGCTGCGAGCTCTGAATGTATCCAAGGAGCAGGTCTGCGACGCGCTC
TGCGAAGGTAACACAGAGAACTTTGGAGCAGAATTGTTGGAGACCTTGCTAAAGATGGCT
CCTACCAAGGAAGAGGAGATCAAATTGAGAGAATTCAAAGAGGAGACATCTCCTATTAAG
CTTGGTCCTGCTGAGAAATTCCTTAAGGCAGTCCTTGATATCCCATTTGCTTTCAAAAGA
GTAGACGCAATGCTTTACATTGCTAACTTTGAATCAGAGGTTAATTACCTGAAGAAGTCC
TTTGAGACCCTTGAGACTGCTTGTGACGAGCTTAGAAACAGCAGGCTGTTTCTGAAGCTA
CTTGAAGCTGTCCTGAAGACTGGCAACAGGATGAATGTTGGAACAAATCGCGGCGATGCA
CACGCGTTCAAGCTTGATACTCTACTCAAATTGGTTGATGTCAAAGGCACTGATGGCAAG
ACTACACTTTTGCATTTTGTCGTGCAGGAGATTATCCGAACGGAGGGCTCCCACCTCTCT
GCTAGCAACCAATCAACTCCACGAACTCAGGCAAACCCTTTACGGGACGAGCTCGAGTGC
AAAAAGCTTGGCCTCCAGGTAGTGGCTGGCCTCGGAAACGAGCTCAGCAATGTCAAGAAG
GCAGCTGCCATGGACTCCGACGTGCTAAGCAGCTATGTCTCGAAACTTGCTGGAGGAATA
GAGAAGATCACTGAGGTGTTGCGGTTGAATGAAGAAGTCAAGTCCAGGGAAGATGCATGG
AGGTTCCATGATTCAATGCAGAAGTTCTTGAAGAGGGCTGATGACGACATCATCAGGGTT
CAGGCTCAGGAGAGCGTTGCGCTATCACTTGTGAAGGAGATCACCGAGTACTTCCATGGT
GACTCTGCGAAAGAGGAAGCTCACCCTTTCAGGATCTTCATGGTGGTCAGGGATTTCCTC
TCAGTTCTTGATCAAGTCTGCAAGGAAGTTGGCAGGATCAATGACCGCACGATCGCTAGC
TCGGTGCGCCATTTCCCAGTACCCGTCAACCCAATGATGCCACAGTTGTTCCCCAGGATT
CATGCTTTGAGAGCTGGAATCTCAGATGATGAAAGTTCAGCCACTTCAGCATCATCACCT
TGA

Protein

961 aa

>Os01t0897700-01 Putative type I Formin, Regulation of root-hair elongation
MPSLRRFLELVVVGIVVCGVNGGSDGLEVAVARRQLHQPFFPDQSSSPPTPAPPGPAPPF
FPALPVPPPPPATAGQEQPTYPALVLPNTGAGGAAATAAPDGGGGGGGGARKSKSSASKL
VPAIVLPLLTVAVLGLSIAFFFTHRRGNAARGGGGGGGCVGGGDAKFLHPERASLFARDE
FGGSGGAAAPPAAAMDYRYVGNAGIGRMDEKSSETTSSGDEASRSTGGSPELRPLPPLLA
RQCGPMGARSPGSGVGGFASPSSGDEEFYSPQGSSKMSTSHRTLAAAVEAAVAARDRSKS
PSPGSIVSTPSYPSSPGATMSPAPASPPLFSSPGQSGRRSVKSRSDSVRTFGQPPAPPPP
PPFAPTLPPPPPPRRKPPSPSPPSSPLIENTSALRSTTTTDTTIPRNPFVQPPPPPTHTH
GPPPPPPPPPPPPVGYWESRVRKPGTGTSKETRSPALSPPPQAASFKSGLPTDAFPGRLA
DNADHAAAAAAGGGGDKSEETTPRPKLKPLHWDKVRASSDRVMVWDQLKSSSFQVNEEMI
ETLFICNPANSAPPKEPATRRPVLPTPKTDNKVLDPKKSQNIAILLRALNVSKEQVCDAL
CEGNTENFGAELLETLLKMAPTKEEEIKLREFKEETSPIKLGPAEKFLKAVLDIPFAFKR
VDAMLYIANFESEVNYLKKSFETLETACDELRNSRLFLKLLEAVLKTGNRMNVGTNRGDA
HAFKLDTLLKLVDVKGTDGKTTLLHFVVQEIIRTEGSHLSASNQSTPRTQANPLRDELEC
KKLGLQVVAGLGNELSNVKKAAAMDSDVLSSYVSKLAGGIEKITEVLRLNEEVKSREDAW
RFHDSMQKFLKRADDDIIRVQAQESVALSLVKEITEYFHGDSAKEEAHPFRIFMVVRDFL
SVLDQVCKEVGRINDRTIASSVRHFPVPVNPMMPQLFPRIHALRAGISDDESSATSASSP
*

5'UTR

chr01:39017796..39017951 (- strand) : 156 bp

CDS

chr01:39016195..39017795 (- strand) : 1601 bp

chr01:39015900..39016105 (- strand) : 206 bp

chr01:39015061..39015308 (- strand) : 248 bp

chr01:39014143..39014970 (- strand) : 828 bp

3'UTR

chr01:39013826..39014142 (- strand) : 317 bp

FASTA

>Os01t0897700-01 class=Sequence position=chr01:39013826..39017951 (- strand)
AAGCTGTATC CACCACGACG ACGTCCACTC CTCTTCTTCC TCCTCTCCTC CTCTCTCTCT CTTCTTTCTC TCTCCTCGCG
AGATCTGTGG CGTCACTGAC CTAGCTTGTT CTTGCTAGCT GCTGCTGCTG CTTCGGCGGT GGCGGTGTGT GTGGCAATGC
CGTCTCTCCG GCGATTCTTG GAGTTGGTGG TGGTTGGGAT TGTTGTGTGT GGTGTCAATG GCGGGAGTGA TGGTTTGGAG
GTTGCGGTGG CGAGGAGGCA GCTGCACCAG CCGTTCTTCC CGGATCAGTC GTCGTCGCCG CCGACGCCGG CGCCGCCCGG
CCCCGCTCCG CCGTTCTTCC CGGCGCTGCC GGTGCCGCCG CCGCCGCCGG CGACGGCGGG GCAGGAGCAG CCGACGTACC
CCGCCCTCGT GCTGCCCAAC ACCGGCGCCG GTGGCGCGGC GGCGACGGCC GCTCCGGATG GAGGTGGTGG TGGTGGTGGT
GGGGCGAGGA AGTCGAAGAG CAGCGCGTCG AAGCTTGTCC CGGCGATTGT GCTGCCGCTG CTCACGGTGG CCGTGCTCGG
GCTGTCCATC GCGTTCTTCT TCACGCACCG GCGTGGGAAT GCGGCGCGCG GGGGAGGAGG AGGCGGCGGG TGCGTCGGTG
GCGGGGACGC CAAGTTCTTG CACCCGGAGA GGGCGAGCCT CTTCGCGCGC GACGAGTTCG GCGGGAGCGG CGGCGCCGCC
GCGCCGCCGG CCGCGGCGAT GGATTACCGC TACGTGGGGA ACGCCGGCAT CGGGCGGATG GACGAGAAGA GCAGCGAGAC
GACGTCGTCG GGCGACGAGG CGTCCCGGAG CACCGGCGGA TCGCCGGAGC TCCGCCCGCT GCCGCCGCTG CTGGCGCGGC
AATGCGGGCC GATGGGCGCG AGGAGCCCCG GCAGCGGCGT CGGCGGGTTC GCGTCGCCGT CGTCCGGCGA CGAGGAATTC
TACTCGCCGC AAGGATCATC CAAGATGTCG ACCTCGCACA GAACGCTCGC CGCCGCGGTC GAAGCCGCTG TGGCCGCGCG
CGACCGCTCC AAGAGCCCCT CGCCCGGCTC GATCGTGAGC ACGCCGTCGT ACCCGTCCTC GCCCGGCGCG ACGATGTCCC
CGGCGCCCGC CTCGCCGCCT CTCTTCTCCA GCCCCGGCCA GTCGGGCCGC CGCTCCGTCA AGTCAAGATC CGATAGCGTG
CGCACCTTCG GCCAACCACC GGCGCCTCCA ccaccacctc ccttcgcgcc gacgctgcca ccgccgcctc cgcctcgccg
gaaaccgccg tcgccatcac cgccctcctc cccactcatc gagaacacgt cggcgctcag atccaccacc accaccgaca
ccaccatccc aagaaaccca ttcgtacaac caccaccccc accgacacac acccacggac caccaccgcc gccgccgccg
ccgcctccgc cgccggtggg ctactgggag agccgcgtgc ggaagcctgg caccggaacg tccaaagaaa cccggtcccc
ggcgctgtcg ccgccgccgc aggccgccag cttcAAGAGC GGTCTACCCA CCGACGCGTT CCCCGGCCGC CTCGCGGACA
ATGCGGACCA CGCCGCCGCC GCCGCGGCCG GCGGCGGCGG CGACAAGTCG GAGGAGACGA CGCCGCGGCC GAAGCTGAAG
CCGCTGCACT GGGACAAGGT CCGGGCAAGC TCCGACCGCG TCATGGTGTG GGATCAGCTC AAATCCAGCT CGTTCCAGTG
AGAACTCCAC CCAAATTCAC AACCTTATTC AGTTCTTGAT CTGTTTTTCT TTTTGTCTAA ATCATTTTGT GGTGAATTCT
TTGCAGGGTG AATGAGGAGA TGATCGAGAC ATTGTTCATC TGCAATCCGG CGAACTCGGC GCCACCGAAG GAGCCAGCAA
CGAGGAGGCC GGTGCTGCCG ACGCCCAAGA CGGACAACAA GGTGCTTGAT CCAAAGAAGT CGCAGAACAT CGCCATCTTG
CTGCGAGCTC TGAATGTATC CAAGGAGCAG GTCTGCGACG CGCTCTGCGA AGGTGAAGAA CATGATCTTT CTCTTAACTT
ACTCATCACA ATTTTGCCAG TTTCTGATGA ACTGCATACT GCATTGAGTT GGGGATTTTT TTGAGATGTT TGCAGCAGTA
TCTGAATTGA TGATACCTTC TAACTAATTG GATTCATTTT TCTCGTGGTT CTTGGTTGAA CACACATGGA GCTTGTGAAT
CGAGATGTTT GTCCGTAGAA TTTGGTTGGG CTTTAAATAC ATTGTCTGAA GAAGTGAATG CCAGCATACA CCCGTTGGTG
GTCGTTGCTG AATTTAGCCG TTTTTAAGCT GAAACTGACT AGTAATTGCT TCTGGATGAC TGAATTAGGT GCATAGAGTT
ATACCTGCGG TGAAGATGGT TAGAGATACC ATTGTTCTGA TGTGAAAACC AGTCTTTCGA TCTACTAGTA TTACTACCGT
AGTTGCTTGA TATAGTATTA CTACTTCTCT GCACATAGTC TTGACTTGGG TGCAAATAAT TGCAAGATAG TTGCATTATT
GCACCAAGTT TCTAGTCAAG TCAATGAGAT TGATCCTTCC TATAGTATTA TCCTTACTAA CGTGGTACCA ATTCACTGAG
CAGGTAACAC AGAGAACTTT GGAGCAGAAT TGTTGGAGAC CTTGCTAAAG ATGGCTCCTA CCAAGGAAGA GGAGATCAAA
TTGAGAGAAT TCAAAGAGGA GACATCTCCT ATTAAGCTTG GTCCTGCTGA GAAATTCCTT AAGGCAGTCC TTGATATCCC
ATTTGCTTTC AAAAGAGTAG ACGCAATGCT TTACATTGCT AACTTTGAAT CAGAGGTTAA TTACCTGAAG AAGTCCTTTG
AGACCCTTGA GGTGAGAATT ATCGTTTCCG AGTTTCCTTT CATACTTATT ATTATATTGA CATCTTACCT ATAACTAAGT
ACATGAAACT TTTCTTAACA GACTGCTTGT GACGAGCTTA GAAACAGCAG GCTGTTTCTG AAGCTACTTG AAGCTGTCCT
GAAGACTGGC AACAGGATGA ATGTTGGAAC AAATCGCGGC GATGCACACG CGTTCAAGCT TGATACTCTA CTCAAATTGG
TTGATGTCAA AGGCACTGAT GGCAAGACTA CACTTTTGCA TTTTGTCGTG CAGGAGATTA TCCGAACGGA GGGCTCCCAC
CTCTCTGCTA GCAACCAATC AACTCCACGA ACTCAGGCAA ACCCTTTACG GGACGAGCTC GAGTGCAAAA AGCTTGGCCT
CCAGGTAGTG GCTGGCCTCG GAAACGAGCT CAGCAATGTC AAGAAGGCAG CTGCCATGGA CTCCGACGTG CTAAGCAGCT
ATGTCTCGAA ACTTGCTGGA GGAATAGAGA AGATCACTGA GGTGTTGCGG TTGAATGAAG AAGTCAAGTC CAGGGAAGAT
GCATGGAGGT TCCATGATTC AATGCAGAAG TTCTTGAAGA GGGCTGATGA CGACATCATC AGGGTTCAGG CTCAGGAGAG
CGTTGCGCTA TCACTTGTGA AGGAGATCAC CGAGTACTTC CATGGTGACT CTGCGAAAGA GGAAGCTCAC CCTTTCAGGA
TCTTCATGGT GGTCAGGGAT TTCCTCTCAG TTCTTGATCA AGTCTGCAAG GAAGTTGGCA GGATCAATGA CCGCACGATC
GCTAGCTCGG TGCGCCATTT CCCAGTACCC GTCAACCCAA TGATGCCACA GTTGTTCCCC AGGATTCATG CTTTGAGAGC
TGGAATCTCA GATGATGAAA GTTCAGCCAC TTCAGCATCA TCACCTTGAT CACCAGTAGT CTGCCAATAG AAATTTTTCG
CAGAGTACTG TGGGAAACCT CCATAGGGCA GAGGGAGACC AACGGCGACG GGGTGTCAAA TTTTTTTTTG AACCTTTTGT
ACCTGTAGAT TATAGAATGT AAGAAGTTTT TTTGCAAATA TTTATTTCTA TATATAAGAG GAGATAAAAT CTAGATCAGA
GGAGGAAATA AGCAGTTCAT GTGTTTGTCA TCTTCAGTCT GTACATGACA CGAGGTAGTG AAACAGCCTG TACAATGTAC
TAACAATTTC AAGTATGGCC AGTCTGCAGA ATTCAAAGGT AAGCTG

Locus: Os01g0897700

Loading...

Locus: Os01g0897700

Loading...