Os01t0907400-01

Locus

Os01g0907400

Description

Histone lysine demethylase, Stress-responsive H3K27me3(histon H3 lysine 27 trimethylation) demethylation

RAP-DB Gene Symbol Synonym(s)

JMJ705

RAP-DB Gene Name Synonym(s)

Jumonji 705, Jumonji C Domain Protein JMJ705

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

JMJ705

Oryzabase Gene Name Synonym(s)

Jumonji 705, Jumonji C Domain Protein JMJ705

Transcript Evidence

AK068952

Protein Evidence

Q5N712

Literature

PMID: 24280387

Note

Manual Curation

January 30, 2014

Gene Ontology (GO)

Molecular Function: nucleic acid binding (GO:0003676)

Molecular Function: metal ion binding (GO:0046872)

Functional domain (InterPro)

Transcription factor jumonji, JmjN (IPR003349)

JmjC domain (IPR003347)

Zinc finger, C2H2-like (IPR015880)

Zinc finger, C2H2 (IPR007087)

Zinc finger C2H2-type/integrase DNA-binding domain (IPR013087)

Full-length cDNA

J023001N18 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0907400-01)

Others

Oryzabase (15200)

KEGG (Os01t0907400-01)

Transcript

4144 bp

>Os01t0907400-01 Histone lysine demethylase, Stress-responsive H3K27me3(histon H3 lysine 27 trimethylation) demethylation
ATTCCCATTTCCTCTCGCTCCCACCAAGACCAACCAAACCCCTGTTTCTCCCTCAAAACC
TCCCTCTCTTTCCCCCCCGAATGCTCGAGCGCTGCGCGGCGGAATCCCCTACTCCCCTCC
GATGAGGCCCTCGCCGCCTCCCGCCGCCCCGGCGGCGGAACCGGTGCCCCCGTGGCTGAG
ATCGCTGCCCGTCGCGCCCGAGTTCCGCCCCACCGCCGCCGAGTTCGCCGATCCCGTCTC
CTACATCCTCAAGATCGAGCCCGCCGCGGCGCCGTACGGCATCTGCAAGGTCGTGCCGCC
GTTGCCCCCGCCGCCGAAGAAGGCCACCTTCTCCAACCTCTCCCGCTCCTTCGCCGCGCT
CCACCCGGACGACCGCTCGCCGTCCTTCCCCACCCGCCACCAGCAGGTCGGCCTCTGCCC
GCGCCGCACGCGCCCGGGGCTCAAGCCCGTGTGGCGGTCCTCCCACCGCTACACGCTCCC
GCAGTTCGAGTCCAAGGCCGGCGCCACCCGCAAGTCGCTCCTCGCCGGCCTCAACTTCCC
TGCCTCCAGGCAACTCACCCCGCTCGACCACGAGGTGCTCTTCTGGCGCGCATCGGCCGA
CCGCCCCATCGTGGTCGAGTATGGCAGCGACATGTCGGGCTCGGGATTCTCCCCTTGCGC
CGCGCAGCCGCAGCCGCCGCCGCAGCAGCAACCGACGGCGCGGGCGGCGGCGCACCTTGG
GGAGACGGCGTGGAACATGCGCGGCGTGGCTAGGAGCCCCGGATCGCTGCTGCGGTTCAT
GCCGGAGGATGTCCCCGGGGTCACCACGCCGATGCTCTACGTCGGGATGATGTTCAGTTG
GTTCGCGTGGCACGTCGAGGACCACGACCTGCACAGCCTCAACTACATGCACCTCGGGGC
CGCCAAGACGTGGTACGGCGTGCCGCGCGACGCCGCGCTCGCGTTCGAGGACGTGGTGCG
CGAACATGGCTACGGCGGGGAGGTGAACCCCCTAGAAACCTTCGCTACATTGGGGCAGAA
AACAACAGTGATGTCCCCTGAAGTGCTTGTGGAGTCGGGTATCCCCTGCTGCAGATTGGT
GCAGAATGCAGGGGAATTTGTGGTCACTTTTCCAGGATCTTATCACTGCGGTTTCAGTCA
TGGATTCAACTGTGGGGAAGCATCAAATATAGCTACTCCTGAATGGTTGAGAATAGCAAA
AGAGGCAGCAATCCGAAGAGCTTCAATCAATCGTCCTCCCATGGTTTCGCACTATCAATT
ACTTTACGATCTCGCACTGTCTATGCGTTTTAGGGAACCATCCAATGGTGAAATGGAGAC
ACGGAGCTCTCGAATAAAGGAGAAGAAGAAATGCGAAGGGGAACAACTGGTCAAGAAGAT
GTTCATCCAAAATGTTATTGAAGATAATGAACTGCTTAGTCATCTTCTAAATGACGGATC
ATCTTGTATTATTCTTCCAGCAAATGCCCATGATGGTCCTGGTCTTTCTACTTTGCGCTC
AACAGATCAATCAAATATGAATTCCAGAATATCACATAACCTATGCAGTAGGGAAGAAGC
TCCAGAAGCCTCAGGATGCTTATCGCCGAACAGGAATGGTGATACCAGAAATTGTATTTC
ATCAGATACGCATAACATGGAAGGTGATAAGGGAGATATAATGAGCGCTACTGGATTGTT
AGATCAGGGTCTATTATCATGTGTCACTTGTGGAATTTTAAGTTTTTCATGTGTGGCTGT
ACTCAAACCAAGAGATTCTACAGCACGATACTTGATGTCTGCTGATTCTAATTCAATTAA
TAACCAGCTTTCTATTTCTGGAGGGAGTATTCTGGCAGATGCGCCAACAAATGAAAGGAA
TGGTGTCATTTCTCGTCCATATTCTGAACACTGTTGCAACGAAATAATGGCCGATGATGC
AGAAATCGATAAGAATTCTGCTCTTGATCTCTTGGCATTTGCTCATGGGGGTCAACCAGA
TCCTGAAGAAGATCCACTGGAGAAAATACTGAAGATTGCACATGGCATTAACAAATCACA
ACCTAATAGTTCAAATAATGTTGGTTGTGTTGGAACAAAGCTGTCCTCAAGTAGCACAGA
GCGCCAAGAAAGACCATCTTCCCAGAACGCTCATTGTAATGGTAGCTCAGTTATTTCAAA
TGGACCGAAAGGTGTTCGCACGAGAAATAAGTATCAACTTAAGATGGTACTTTCTGAAGG
TTTTCAGGCAAAGGATATCTATTCTGCGAAGGAAAAGAAGGTTCAATCAGAACCATCAAG
CTCAAAAGGGGATGTTAAGGAGACAATTGATGTTAGTGGCACAGAGAACGATGTCGGATG
TAAAAGCACTACAATCTCTGTCAGTGAACACAGGGGTTCTACAAAGAATATGTATTCAGT
GAAGGAAAAGAAGGTTCAATCGAAACCATCAAGCTTAAAGGGGACTGTTAAAGAGACAGT
TGATGTCAGTGGCACAGAGAACGATGCTAGATGTAAAAGCATTACAATCTCTGTCAGTGA
ACACAGGGGTTCTACACCTATGACCAATAGTTTAGCTGCATCAATCGTGAAACCTGACAA
GGATTCATCAAGAATGCATGTATTTTGTCTTGAGCATGCTATTGAGGTTGAGAAGCAACT
GCATGCTATAGGTGGTTCTAATATTATGCTTATATGTCGTCCAGAATATCCCAAAATAGA
AGCGGAAGCAAGATTGTTGGGTGAAGAAATGGGACTGGTATATGACTGGAAGGGCATTCA
TTTCAAGGAGGCCAACATGGAGGACAGGCAGAAGATACAGGAAGTTCTGCGGGATGAGGA
AGCAATACCTACAAGCAGTGATTGGGCTGTAAAATTGGGTATTAACCTTTATTATAGTGC
AAATCTGGCCAAATCTCCTTTATATAACAAACAAATGCCATACAACAGAGTCATTTATAG
GGCATTTGGCTGTGATTCTCCTAATGACTCGCCAGTAATGTTCAATACTTGCGAAAGGAA
ACAAAGCCACCAGAAGAAAATAGTGGTTGCTGGCCGGTGGTGTGGGAAAGTATGGATGTC
AAAACAGGTCCATCCATACTTGGCTCACAGAGTTGAAAGCCAGGAAGCGGAAGAAGCAGA
TAGAATCTGTTCTTATCATTTTGATGAGAAGCACAAAGCTGAGCCAGTTGGGAATTCTAG
TAGAGTGGAAGCCTCCAAAAGAAAGAGTAGCAGTTTGACAGACGTAACAGAATCAAGCAA
TAGAAGGGGGGAAATACCTGGTGAGGAAACAAACACCAAGAGGCCCAAACATTCTCAAGA
GAACAATCTCAGAGCTTTGGAAACCGCTGCTGAAGTTGTGGTGCCCTCACCAGCTGGAAC
AGGTCTCCGCGTTAGCTCCAGGATTGCCAACAGGGCAAACAAGCTAAAATCAAAGATGGA
AAAGGAGGATGTCCCTTCTAGCCGTCCAAAGTCTAACATAAAGGAGAAAAGCAGTCATGC
TAGCGGTCAGAAATCAAATGTTCAAGAGGCGAATGCTAATTCTGCTAGCCATTTGAGAGC
AATGCCACCAAAACAGAAGGCTGAAGCAGAAGCAAAGAAGCAAATAAGAACTCCAAAACC
TCCAAAGCAAGCAGTGGAGTACTCGTGCGATATTGAGGGTTGTTCTATGAGTTTTCGTAC
AAAGCGGGACTTGTCTCTGCACAAGAGTGATATCTGCCCAGTGAAAGGCTGCGGGAAGAA
GTTCTTCTCGCACAAGTATCTGCTGCAGCATCGCAAGGTTCACACAGATGACCGTCCGCT
AACATGCCCATGGAAGGGCTGCAACATGGCATTCAAGTGGCCATGGGCAAGGACTGAACA
TCTCAGGGTTCATACAGGCGACAGGCCCTATGTTTGCCATGAGCCAGGTTGCGCACAGAC
ATTCAGGTTTGTCTCAGATTTCAGCCGTCACAAGCGCAAGACAGGTCATTCTGTCAAGAA
GAAGAAGAAAGCAAAGAGTTGAGCTCGTATTACAGCAAGCTAGTTATGGTAGAACCGGAC
GCAGTAGGAGGTAGTTTGTACATTCTACTTCACTAGTTTAGCACTGATCTCTCTATCTGA
CGGATTCTGTTGGCACCACAATCGGTGTGCTTTGTGTTAGTTTATATTAGTTTTCATGAT
TACT

CDS

3861 bp

>Os01t0907400-01 Histone lysine demethylase, Stress-responsive H3K27me3(histon H3 lysine 27 trimethylation) demethylation
ATGAGGCCCTCGCCGCCTCCCGCCGCCCCGGCGGCGGAACCGGTGCCCCCGTGGCTGAGA
TCGCTGCCCGTCGCGCCCGAGTTCCGCCCCACCGCCGCCGAGTTCGCCGATCCCGTCTCC
TACATCCTCAAGATCGAGCCCGCCGCGGCGCCGTACGGCATCTGCAAGGTCGTGCCGCCG
TTGCCCCCGCCGCCGAAGAAGGCCACCTTCTCCAACCTCTCCCGCTCCTTCGCCGCGCTC
CACCCGGACGACCGCTCGCCGTCCTTCCCCACCCGCCACCAGCAGGTCGGCCTCTGCCCG
CGCCGCACGCGCCCGGGGCTCAAGCCCGTGTGGCGGTCCTCCCACCGCTACACGCTCCCG
CAGTTCGAGTCCAAGGCCGGCGCCACCCGCAAGTCGCTCCTCGCCGGCCTCAACTTCCCT
GCCTCCAGGCAACTCACCCCGCTCGACCACGAGGTGCTCTTCTGGCGCGCATCGGCCGAC
CGCCCCATCGTGGTCGAGTATGGCAGCGACATGTCGGGCTCGGGATTCTCCCCTTGCGCC
GCGCAGCCGCAGCCGCCGCCGCAGCAGCAACCGACGGCGCGGGCGGCGGCGCACCTTGGG
GAGACGGCGTGGAACATGCGCGGCGTGGCTAGGAGCCCCGGATCGCTGCTGCGGTTCATG
CCGGAGGATGTCCCCGGGGTCACCACGCCGATGCTCTACGTCGGGATGATGTTCAGTTGG
TTCGCGTGGCACGTCGAGGACCACGACCTGCACAGCCTCAACTACATGCACCTCGGGGCC
GCCAAGACGTGGTACGGCGTGCCGCGCGACGCCGCGCTCGCGTTCGAGGACGTGGTGCGC
GAACATGGCTACGGCGGGGAGGTGAACCCCCTAGAAACCTTCGCTACATTGGGGCAGAAA
ACAACAGTGATGTCCCCTGAAGTGCTTGTGGAGTCGGGTATCCCCTGCTGCAGATTGGTG
CAGAATGCAGGGGAATTTGTGGTCACTTTTCCAGGATCTTATCACTGCGGTTTCAGTCAT
GGATTCAACTGTGGGGAAGCATCAAATATAGCTACTCCTGAATGGTTGAGAATAGCAAAA
GAGGCAGCAATCCGAAGAGCTTCAATCAATCGTCCTCCCATGGTTTCGCACTATCAATTA
CTTTACGATCTCGCACTGTCTATGCGTTTTAGGGAACCATCCAATGGTGAAATGGAGACA
CGGAGCTCTCGAATAAAGGAGAAGAAGAAATGCGAAGGGGAACAACTGGTCAAGAAGATG
TTCATCCAAAATGTTATTGAAGATAATGAACTGCTTAGTCATCTTCTAAATGACGGATCA
TCTTGTATTATTCTTCCAGCAAATGCCCATGATGGTCCTGGTCTTTCTACTTTGCGCTCA
ACAGATCAATCAAATATGAATTCCAGAATATCACATAACCTATGCAGTAGGGAAGAAGCT
CCAGAAGCCTCAGGATGCTTATCGCCGAACAGGAATGGTGATACCAGAAATTGTATTTCA
TCAGATACGCATAACATGGAAGGTGATAAGGGAGATATAATGAGCGCTACTGGATTGTTA
GATCAGGGTCTATTATCATGTGTCACTTGTGGAATTTTAAGTTTTTCATGTGTGGCTGTA
CTCAAACCAAGAGATTCTACAGCACGATACTTGATGTCTGCTGATTCTAATTCAATTAAT
AACCAGCTTTCTATTTCTGGAGGGAGTATTCTGGCAGATGCGCCAACAAATGAAAGGAAT
GGTGTCATTTCTCGTCCATATTCTGAACACTGTTGCAACGAAATAATGGCCGATGATGCA
GAAATCGATAAGAATTCTGCTCTTGATCTCTTGGCATTTGCTCATGGGGGTCAACCAGAT
CCTGAAGAAGATCCACTGGAGAAAATACTGAAGATTGCACATGGCATTAACAAATCACAA
CCTAATAGTTCAAATAATGTTGGTTGTGTTGGAACAAAGCTGTCCTCAAGTAGCACAGAG
CGCCAAGAAAGACCATCTTCCCAGAACGCTCATTGTAATGGTAGCTCAGTTATTTCAAAT
GGACCGAAAGGTGTTCGCACGAGAAATAAGTATCAACTTAAGATGGTACTTTCTGAAGGT
TTTCAGGCAAAGGATATCTATTCTGCGAAGGAAAAGAAGGTTCAATCAGAACCATCAAGC
TCAAAAGGGGATGTTAAGGAGACAATTGATGTTAGTGGCACAGAGAACGATGTCGGATGT
AAAAGCACTACAATCTCTGTCAGTGAACACAGGGGTTCTACAAAGAATATGTATTCAGTG
AAGGAAAAGAAGGTTCAATCGAAACCATCAAGCTTAAAGGGGACTGTTAAAGAGACAGTT
GATGTCAGTGGCACAGAGAACGATGCTAGATGTAAAAGCATTACAATCTCTGTCAGTGAA
CACAGGGGTTCTACACCTATGACCAATAGTTTAGCTGCATCAATCGTGAAACCTGACAAG
GATTCATCAAGAATGCATGTATTTTGTCTTGAGCATGCTATTGAGGTTGAGAAGCAACTG
CATGCTATAGGTGGTTCTAATATTATGCTTATATGTCGTCCAGAATATCCCAAAATAGAA
GCGGAAGCAAGATTGTTGGGTGAAGAAATGGGACTGGTATATGACTGGAAGGGCATTCAT
TTCAAGGAGGCCAACATGGAGGACAGGCAGAAGATACAGGAAGTTCTGCGGGATGAGGAA
GCAATACCTACAAGCAGTGATTGGGCTGTAAAATTGGGTATTAACCTTTATTATAGTGCA
AATCTGGCCAAATCTCCTTTATATAACAAACAAATGCCATACAACAGAGTCATTTATAGG
GCATTTGGCTGTGATTCTCCTAATGACTCGCCAGTAATGTTCAATACTTGCGAAAGGAAA
CAAAGCCACCAGAAGAAAATAGTGGTTGCTGGCCGGTGGTGTGGGAAAGTATGGATGTCA
AAACAGGTCCATCCATACTTGGCTCACAGAGTTGAAAGCCAGGAAGCGGAAGAAGCAGAT
AGAATCTGTTCTTATCATTTTGATGAGAAGCACAAAGCTGAGCCAGTTGGGAATTCTAGT
AGAGTGGAAGCCTCCAAAAGAAAGAGTAGCAGTTTGACAGACGTAACAGAATCAAGCAAT
AGAAGGGGGGAAATACCTGGTGAGGAAACAAACACCAAGAGGCCCAAACATTCTCAAGAG
AACAATCTCAGAGCTTTGGAAACCGCTGCTGAAGTTGTGGTGCCCTCACCAGCTGGAACA
GGTCTCCGCGTTAGCTCCAGGATTGCCAACAGGGCAAACAAGCTAAAATCAAAGATGGAA
AAGGAGGATGTCCCTTCTAGCCGTCCAAAGTCTAACATAAAGGAGAAAAGCAGTCATGCT
AGCGGTCAGAAATCAAATGTTCAAGAGGCGAATGCTAATTCTGCTAGCCATTTGAGAGCA
ATGCCACCAAAACAGAAGGCTGAAGCAGAAGCAAAGAAGCAAATAAGAACTCCAAAACCT
CCAAAGCAAGCAGTGGAGTACTCGTGCGATATTGAGGGTTGTTCTATGAGTTTTCGTACA
AAGCGGGACTTGTCTCTGCACAAGAGTGATATCTGCCCAGTGAAAGGCTGCGGGAAGAAG
TTCTTCTCGCACAAGTATCTGCTGCAGCATCGCAAGGTTCACACAGATGACCGTCCGCTA
ACATGCCCATGGAAGGGCTGCAACATGGCATTCAAGTGGCCATGGGCAAGGACTGAACAT
CTCAGGGTTCATACAGGCGACAGGCCCTATGTTTGCCATGAGCCAGGTTGCGCACAGACA
TTCAGGTTTGTCTCAGATTTCAGCCGTCACAAGCGCAAGACAGGTCATTCTGTCAAGAAG
AAGAAGAAAGCAAAGAGTTGA

Protein

1287 aa

>Os01t0907400-01 Histone lysine demethylase, Stress-responsive H3K27me3(histon H3 lysine 27 trimethylation) demethylation
MRPSPPPAAPAAEPVPPWLRSLPVAPEFRPTAAEFADPVSYILKIEPAAAPYGICKVVPP
LPPPPKKATFSNLSRSFAALHPDDRSPSFPTRHQQVGLCPRRTRPGLKPVWRSSHRYTLP
QFESKAGATRKSLLAGLNFPASRQLTPLDHEVLFWRASADRPIVVEYGSDMSGSGFSPCA
AQPQPPPQQQPTARAAAHLGETAWNMRGVARSPGSLLRFMPEDVPGVTTPMLYVGMMFSW
FAWHVEDHDLHSLNYMHLGAAKTWYGVPRDAALAFEDVVREHGYGGEVNPLETFATLGQK
TTVMSPEVLVESGIPCCRLVQNAGEFVVTFPGSYHCGFSHGFNCGEASNIATPEWLRIAK
EAAIRRASINRPPMVSHYQLLYDLALSMRFREPSNGEMETRSSRIKEKKKCEGEQLVKKM
FIQNVIEDNELLSHLLNDGSSCIILPANAHDGPGLSTLRSTDQSNMNSRISHNLCSREEA
PEASGCLSPNRNGDTRNCISSDTHNMEGDKGDIMSATGLLDQGLLSCVTCGILSFSCVAV
LKPRDSTARYLMSADSNSINNQLSISGGSILADAPTNERNGVISRPYSEHCCNEIMADDA
EIDKNSALDLLAFAHGGQPDPEEDPLEKILKIAHGINKSQPNSSNNVGCVGTKLSSSSTE
RQERPSSQNAHCNGSSVISNGPKGVRTRNKYQLKMVLSEGFQAKDIYSAKEKKVQSEPSS
SKGDVKETIDVSGTENDVGCKSTTISVSEHRGSTKNMYSVKEKKVQSKPSSLKGTVKETV
DVSGTENDARCKSITISVSEHRGSTPMTNSLAASIVKPDKDSSRMHVFCLEHAIEVEKQL
HAIGGSNIMLICRPEYPKIEAEARLLGEEMGLVYDWKGIHFKEANMEDRQKIQEVLRDEE
AIPTSSDWAVKLGINLYYSANLAKSPLYNKQMPYNRVIYRAFGCDSPNDSPVMFNTCERK
QSHQKKIVVAGRWCGKVWMSKQVHPYLAHRVESQEAEEADRICSYHFDEKHKAEPVGNSS
RVEASKRKSSSLTDVTESSNRRGEIPGEETNTKRPKHSQENNLRALETAAEVVVPSPAGT
GLRVSSRIANRANKLKSKMEKEDVPSSRPKSNIKEKSSHASGQKSNVQEANANSASHLRA
MPPKQKAEAEAKKQIRTPKPPKQAVEYSCDIEGCSMSFRTKRDLSLHKSDICPVKGCGKK
FFSHKYLLQHRKVHTDDRPLTCPWKGCNMAFKWPWARTEHLRVHTGDRPYVCHEPGCAQT
FRFVSDFSRHKRKTGHSVKKKKKAKS*

5'UTR

chr01:39493173..39493293 (+ strand) : 121 bp

CDS

chr01:39493294..39494167 (+ strand) : 874 bp

chr01:39494265..39494343 (+ strand) : 79 bp

chr01:39494694..39494761 (+ strand) : 68 bp

chr01:39495351..39495501 (+ strand) : 151 bp

chr01:39496315..39496895 (+ strand) : 581 bp

chr01:39497364..39498173 (+ strand) : 810 bp

chr01:39498479..39499776 (+ strand) : 1298 bp

3'UTR

chr01:39499777..39499938 (+ strand) : 162 bp

FASTA

>Os01t0907400-01 class=Sequence position=chr01:39493173..39499938 (+ strand)
ATTCCCATTT CCTCTCGCTC CCACCAAGAC CAACCAAACC CCTGTTTCTC CCTCAAAACC TCCCTCTCTT TCCCCCCCGA
ATGCTCGAGC GCTGCGCGGC GGAATCCCCT ACTCCCCTCC GATGAGGCCC TCGCCGCCTC CCGCCGCCCC GGCGGCGGAA
CCGGTGCCCC CGTGGCTGAG ATCGCTGCCC GTCGCGCCCG AGTTCCGCCC CACCGCCGCC GAGTTCGCCG ATCCCGTCTC
CTACATCCTC AAGATCGAGC CCGCCGCGGC GCCGTACGGC ATCTGCAAGG TCGTGCCGCC GTTGCCCCCG CCGCCGAAGA
AGGCCACCTT CTCCAACCTC TCCCGCTCCT TCGCCGCGCT CCACCCGGAC GACCGCTCGC CGTCCTTCCC CACCCGCCAC
CAGCAGGTCG GCCTCTGCCC GCGCCGCACG CGCCCGGGGC TCAAGCCCGT GTGGCGGTCC TCCCACCGCT ACACGCTCCC
GCAGTTCGAG TCCAAGGCCG GCGCCACCCG CAAGTCGCTC CTCGCCGGCC TCAACTTCCC TGCCTCCAGG CAACTCACCC
CGCTCGACCA CGAGGTGCTC TTCTGGCGCG CATCGGCCGA CCGCCCCATC GTGGTCGAGT ATGGCAGCGA CATGTCGGGC
TCGGGATTCT CCCCTTGCGC CGCGCAGCCG CAGCCGCCGC CGCAGCAGCA ACCGACGGCG CGGGCGGCGG CGCACCTTGG
GGAGACGGCG TGGAACATGC GCGGCGTGGC TAGGAGCCCC GGATCGCTGC TGCGGTTCAT GCCGGAGGAT GTCCCCGGGG
TCACCACGCC GATGCTCTAC GTCGGGATGA TGTTCAGTTG GTTCGCGTGG CACGTCGAGG ACCACGACCT GCACAGCCTC
AACTACATGC ACCTCGGGGC CGCCAAGACG TGGTACGGCG TGCCGCGCGA CGCCGCGCTC GCGTTCGAGG ACGTGGTGCG
CGAACATGGC TACGGCGGGG AGGTGAACCC CCTAGGTGAG GCGCTTGAAA CTATCAATTT TCATTAGGAA CACGCTATGC
TCTGTTTTCC CAATTCTGAA TTGGTTTTCC TGAACTGCGA GTTGGTATGC AGAAACCTTC GCTACATTGG GGCAGAAAAC
AACAGTGATG TCCCCTGAAG TGCTTGTGGA GTCGGGTATC CCCTGCTGCA GGTGTTATTT CCTTCTGTTT GTTCAGTAAC
TAGCCAAATT TCCCGTGCAA TTTTGCATGG AACTAGCTTA AAGTTTATTT GATGTAGAAT TGCTTTTGGT ATACGTCTTC
TGCTTCTATT TCTATAAATA CAATCTATAC CATTATAAGT TGAACCCGAC ATGATCAAAG CATACATATA TCTCTTTTCT
CAGATTATTA ATGTTGTGAT TTCTAGGCCC TCAGTGAATT TGGTGGACTC TTTTAGCCTT CTCTTTATTA ATAATATATT
CCATAATAGA TAGATATATT TTCTATGGTA TGTGCCATGT CTACCAGTGG TTTGATTAAT TGATTCTCTG TGTTTGAACA
GATTGGTGCA GAATGCAGGG GAATTTGTGG TCACTTTTCC AGGATCTTAT CACTGCGGTT TCAGTCATGG TGAGACTGAG
CAATCACAAT AGCTAGCCTC ATTTTCCTAT GCTACATTTT GTACACAATT ATTCCTGTTC TAATCATGCC TATGACATTT
TTTTTCATCC CTAACTGCAT GAAATATATG TCTTACACAG GGTGCAATAC CCATAGAATG CCAACCTTTT ATTGAGACAT
GCCTATACCA GGAAAACTTA TAACTCTTTT TTTTTTAAAA AAAAACATGT GTATACCATG TGCAGTGCAA AACAAATAGG
TATTCTATCT ACTGAGTTAA TCAGATGTGA TTGCAGGATA TTGTGTAAAA GATTTGAAGT GTTTACTAAA AATAGTGAAT
TAACCTATAT TTGTGCTAAA CGTCTGCCCT ACCCTAGTAC GTTACAACTA TTATGATGTT ACCATTTCCT GAATTCGATT
GTTCATCTTG ACACGGGCAC TCTTCATTTC ATTCCAGCAA CACAGGTGTA CTGTGTGCAA TATGCAATTG CAAAATGTGT
CTCTGTTGTA ACCACTGCAA TGCACTTGAT CACTGCCTCT TTCATATAAT TAATCTAATC AACCTCATGA CTCATGAGGG
CATCATCTAT TTGGGCAGGA TTCAACTGTG GGGAAGCATC AAATATAGCT ACTCCTGAAT GGTTGAGAAT AGCAAAAGAG
GCAGCAATCC GAAGAGCTTC AATCAATCGT CCTCCCATGG TTTCGCACTA TCAATTACTT TACGATCTCG CACTGTCTAT
GCGTTTTAGG TATGTCATAA TTTGCATGTT TCATGATGTG CACTTGTTCT TGATTTCTTG TGAGAGATTC TATCAACTTC
TGCCCCCCAT AAAATACTTA TCTCACAGCC CAGTTTGGCA CTTTGGCTAT GGCGCATTTC TTCTCCCTGT ATTAACTTAG
AGTACATTAG AGTAGATTTT GGAAAACCCT GTTTCATGAC GTGCACTTAT TCTTGATTTC TTGCGAGAGA TTTTGTCAAC
TTCTGCCTCC CAGAAAAATA CTTATCTGAC AACCCATTTT GGCACTTTGG CTATGGCACG TTTCTTAATC ACTGGATAAC
TTAGATTATG TTAGAGTAGA TTTTAGAAAA CCCCATGTTT TTGTGAAACC TTAGACCATA ATACCTAGGG GTTATATGAC
GTAAGCCATA ATACCTAGGT TTTTTTTTCC AACTTTGATG GCATGACCTT TTTTTCCTTA AAATAAATCA TTATGCTATC
AATAAAAATG GTCAGCCAGT TAGTGCAGAA TCAATAATTT CCATGTATTG ACCTGTGCAC GACTCTGCTC AGTGATGCAA
GTATCCCCAT TCCCACGTAT GCAACATCAA TAAAGTCTTA AAATATTCCA CCGTAGTGTC TTACGGTAGC CAAGGTTTTT
ATGGTGATGC TTCAATCTGT TAGCGGTTAG CGATGTATAT GTGTTATGAG AGCTGCTTTC TGACAGAACT CTTTTGATAC
TTGCTGATGC TATATGAAAA TAAGACAATC TTTTTTATGC ATTTGCCCCC TTCATTTTTT TATGGCAATC CTTTATCTTG
TTTTGAACTT CTACTTCTTC AGGGAACCAT CCAATGGTGA AATGGAGACA CGGAGCTCTC GAATAAAGGA GAAGAAGAAA
TGCGAAGGGG AACAACTGGT CAAGAAGATG TTCATCCAAA ATGTTATTGA AGATAATGAA CTGCTTAGTC ATCTTCTAAA
TGACGGATCA TCTTGTATTA TTCTTCCAGC AAATGCCCAT GATGGTCCTG GTCTTTCTAC TTTGCGCTCA ACAGATCAAT
CAAATATGAA TTCCAGAATA TCACATAACC TATGCAGTAG GGAAGAAGCT CCAGAAGCCT CAGGATGCTT ATCGCCGAAC
AGGAATGGTG ATACCAGAAA TTGTATTTCA TCAGATACGC ATAACATGGA AGGTGATAAG GGAGATATAA TGAGCGCTAC
TGGATTGTTA GATCAGGGTC TATTATCATG TGTCACTTGT GGAATTTTAA GTTTTTCATG TGTGGCTGTA CTCAAACCAA
GAGATTCTAC AGCACGATAC TTGATGTCTG CTGATTCTAA TTCAATTAAT AACCAGCTTT CTATTTCTGG AGGGAGTATT
CTGGCAGATG CGCCAACAAA TGAAAGGAAT GGTGTCATTT CTCGTAAGTT TTCATCTTAC AATCTGTACT GAAGACATTT
TATTTCTTAC GCTCTTGTTT TCAGCTTATC TTATGTACTT CCACATTAAA AGGGTAGTGA GTTACTgata ttttttttcc
ttctaaggta gtaaaagaat tgctattagg tgccatagat tattgatcta tcataactaa ggaaaattta ccctgtacga
attggatgtt ttgaaacaaa taaacctccT TTATAACTCC ATATCTAATG AAATGATCTA TTGGAGTTTC TTATGTGTTT
TTACTATGGG AATGAATGGA CTGTGGTTCT ATATTTGTTT ATCTGCATTT GTGGTAGGTA TAATCAGGTG CTTGTAGGGA
CATTTAATTT TCAGTTAATT TGGTGAGCCG AATGCTATTT ACTATTTTGT CCATGTGCTT TAACAATCAT TTTCATCTGA
TACAGTATAT GCATTTGTAA TCAACACACA GGTCCATATT CTGAACACTG TTGCAACGAA ATAATGGCCG ATGATGCAGA
AATCGATAAG AATTCTGCTC TTGATCTCTT GGCATTTGCT CATGGGGGTC AACCAGATCC TGAAGAAGAT CCACTGGAGA
AAATACTGAA GATTGCACAT GGCATTAACA AATCACAACC TAATAGTTCA AATAATGTTG GTTGTGTTGG AACAAAGCTG
TCCTCAAGTA GCACAGAGCG CCAAGAAAGA CCATCTTCCC AGAACGCTCA TTGTAATGGT AGCTCAGTTA TTTCAAATGG
ACCGAAAGGT GTTCGCACGA GAAATAAGTA TCAACTTAAG ATGGTACTTT CTGAAGGTTT TCAGGCAAAG GATATCTATT
CTGCGAAGGA AAAGAAGGTT CAATCAGAAC CATCAAGCTC AAAAGGGGAT GTTAAGGAGA CAATTGATGT TAGTGGCACA
GAGAACGATG TCGGATGTAA AAGCACTACA ATCTCTGTCA GTGAACACAG GGGTTCTACA AAGAATATGT ATTCAGTGAA
GGAAAAGAAG GTTCAATCGA AACCATCAAG CTTAAAGGGG ACTGTTAAAG AGACAGTTGA TGTCAGTGGC ACAGAGAACG
ATGCTAGATG TAAAAGCATT ACAATCTCTG TCAGTGAACA CAGGGGTTCT ACACCTATGA CCAATAGTTT AGCTGCATCA
ATCGTGAAAC CTGACAAGGA TTCATCAAGA ATGCATGTAT TTTGTCTTGA GCATGCTATT GAGGTTGAGA AGCAACTGCA
TGCTATAGGT GGTTCTAATA TTATGCTTAT ATGTCGTCCA GGTTAGTCAT CAAGCTGTTT GCTCACTGTT ATGAAGTGCA
ATTCATTTTC AACCATTTTT AAGCATTTTT CTGCATGCCT TTTATTGTTT TCATTGGTAA TTGGTTCATA GTATGACTTA
GCACTTTAGC AGTGACACCA TATCTGTACA CATGCCATCT TACATGATGT TCCTATTAGC TTTGCTGAAA TCAGAATAAG
TAGGTTGAAC CTTTTGGTGC TTCTGATGTT CATAATACTA AATTTTCAAG ACTGCTGCAT ATGTTCTTAA AACATTAATT
AACTTTTTTT GTTATGATTT GTACAGAATA TCCCAAAATA GAAGCGGAAG CAAGATTGTT GGGTGAAGAA ATGGGACTGG
TATATGACTG GAAGGGCATT CATTTCAAGG AGGCCAACAT GGAGGACAGG CAGAAGATAC AGGAAGTTCT GCGGGATGAG
GAAGCAATAC CTACAAGCAG TGATTGGGCT GTAAAATTGG GTATTAACCT TTATTATAGT GCAAATCTGG CCAAATCTCC
TTTATATAAC AAACAAATGC CATACAACAG AGTCATTTAT AGGGCATTTG GCTGTGATTC TCCTAATGAC TCGCCAGTAA
TGTTCAATAC TTGCGAAAGG AAACAAAGCC ACCAGAAGAA AATAGTGGTT GCTGGCCGGT GGTGTGGGAA AGTATGGATG
TCAAAACAGG TCCATCCATA CTTGGCTCAC AGAGTTGAAA GCCAGGAAGC GGAAGAAGCA GATAGAATCT GTTCTTATCA
TTTTGATGAG AAGCACAAAG CTGAGCCAGT TGGGAATTCT AGTAGAGTGG AAGCCTCCAA AAGAAAGAGT AGCAGTTTGA
CAGACGTAAC AGAATCAAGC AATAGAAGGG GGGAAATACC TGGTGAGGAA ACAAACACCA AGAGGCCCAA ACATTCTCAA
GAGAACAATC TCAGAGCTTT GGAAACCGCT GCTGAAGTTG TGGTGCCCTC ACCAGCTGGA ACAGGTCTCC GCGTTAGCTC
CAGGATTGCC AACAGGGCAA ACAAGCTAAA ATCAAAGATG GAAAAGGAGG ATGTCCCTTC TAGCCGTCCA AAGTCTAACA
TAAAGGAGAA AAGCAGTCAT GCTAGCGGTC AGAAATCAAA TGTTCAAGAG GCGAATGCTA ATTCTGCTAG CCATTTGAGA
GCAATGCCAC CAAAACAGAA GGCTGAAGCA GAAGCAAAGA AGCAAATAAG AACTCCAAAA CCTCCAAAGC AAGCAGTGGA
GTACTCGTGC GATATTGAGG GTTGTTCTAT GAGTTTTCGT ACAAAGCGGG ACTTGTCTCT GCACAAGAGT GATATCTGCC
CAGTGAAAGG CTGCGGGAAG AAGTTCTTCT CGCACAAGTA TCTGCTGCAG CATCGCAAGG TTCACACAGA TGACCGTCCG
CTAACATGCC CATGGAAGGG CTGCAACATG GCATTCAAGT GGCCATGGGC AAGGACTGAA CATCTCAGGG TTCATACAGG
CGACAGGCCC TATGTTTGCC ATGAGCCAGG TTGCGCACAG ACATTCAGGT TTGTCTCAGA TTTCAGCCGT CACAAGCGCA
AGACAGGTCA TTCTGTCAAG AAGAAGAAGA AAGCAAAGAG TTGAGCTCGT ATTACAGCAA GCTAGTTATG GTAGAACCGG
ACGCAGTAGG AGGTAGTTTG TACATTCTAC TTCACTAGTT TAGCACTGAT CTCTCTATCT GACGGATTCT GTTGGCACCA
CAATCGGTGT GCTTTGTGTT AGTTTATATT AGTTTTCATG ATTACT

Locus: Os01g0907400

Loading...

Locus: Os01g0907400

Loading...