Os01t0909200-01

Locus

Os01g0909200

Description

Dicer-like 3 homolog, 24-nt siRNA processing, Control of agricultural trait

RAP-DB Gene Symbol Synonym(s)

OsDCL3a

RAP-DB Gene Name Synonym(s)

Dicer-like 3a

CGSNL Gene Symbol

DCL3A

CGSNL Gene Name

DICER-LIKE 3A

Oryzabase Gene Symbol Synonym(s)

OsDCL3a

Oryzabase Gene Name Synonym(s)

Endoribonuclease Dicer homolog 3a, Dicer-like protein 3a

Transcript Evidence

AK120075

Protein Evidence

Q5N870

Literature

PMID: 24554078

PMID: 21973320

Note

Manual Curation

December 5, 2019

Gene Ontology (GO)

Biological Process: RNA processing (GO:0006396)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: ribonuclease III activity (GO:0004525)

Molecular Function: protein binding (GO:0005515)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: hydrolase activity (GO:0016787)

Molecular Function: endoribonuclease activity, producing 5'-phosphomonoesters (GO:0016891)

Functional domain (InterPro)

P-loop containing nucleoside triphosphate hydrolase (IPR027417)

Dicer dimerisation domain superfamily (IPR038248)

PAZ domain superfamily (IPR036085)

Ribonuclease III, endonuclease domain superfamily (IPR036389)

Helicase superfamily 1/2, ATP-binding domain (IPR014001)

Helicase/UvrB, N-terminal (IPR006935)

Helicase, C-terminal (IPR001650)

Dicer dimerisation domain (IPR005034)

PAZ domain (IPR003100)

Ribonuclease III domain (IPR000999)

Full-length cDNA

J013008L07 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0909200-01)

RiceXPro (AK120075)

Others

Oryzabase (8309)

KEGG (Os01t0909200-01 (EC:3.1.26.-))

Transcript

5511 bp

>Os01t0909200-01 Dicer-like 3 homolog, 24-nt siRNA processing, Control of agricultural trait
GTAGTGGCCTCTGTCGTCCGTGAGTTACCCTGACCCCTCCTCGTCAGTTTGCCCGCCGCG
GCGCCGCCGCCGCCGCCGCCGATCCCCATCCATCCCGCGAGCGAGCAGGGCGCCGTCGTT
CGTCCTGCTGCATCCGCCGCATCCTGTAAACATGAACCCTTTAAAGAGGTCATTGGAATC
ATCTTCTCAGGAACATGAAGCAGGCAAACAGAAACTGCAGAAGAGAGAGTGTCAAGATTT
CACTCCCAGAAGATATCAGCTTGATGTCTATGAGGTTGCAATGCGGAGAAACACGATTGC
GATGCTTGACACAGGAGCCGGGAAGACAATGATTGCTGTGATGCTTATCAAGGAGTTCGG
AAAGATAAACAGAACAAAGAATGCTGGAAAAGTCATCATATTTCTTGCACCAACAGTTCA
ACTTGTTACACAGCAATGCGAGGTGATTGAAATCCACACAGATTTTGAGGTAGAACAATA
CTATGGTGCAAAGGGGGTTGATCAATGGACAGGTCCTAGATGGCAAGAGCAAATCTCAAA
ATACCAGGTCATGGTCATGACACCACAGGTGTTCCTACAAGCTTTACGCAATGCTTTCTT
AATCTTGGACATGGTTAGTCTCATGATATTTGATGAATGCCATCATGCAACTGGAAACCA
CCCTTATACAAGAATAATGAAGGAGTTCTATCACAAATCAGAACATAAGCCAAGTGTGTT
TGGTATGACAGCATCACCTGTTATAAGAAAAGGTATCTCTTCTCATTTGGATTGTGAAGG
TCAGTTCTGTGAATTGGAGAACCTGTTAGATGCTAAGATCTACACAGTTTCAGATAGAGA
AGAGATAGAGTTTTGTGTTCCTTCTGCAAAAGAAATGTGCAGGTACTATGACTCGAAACC
AGTTTGTTTTGAAGATTTGAGTGAAGAATTGGGAGTTTTATGTTCCAAGTATGATGCATT
GATAACAGAGTTGCAGAATAAGCGAAGCGACATGTATAAAGATGCTGATGATATAACAAA
AGAATCAAAGAGACGCCTTTCTAAATCTATAGCAAAAATTTGCTACTGCCTTGATGATGT
TGGTCTTATTTGTGCAAGTGAGGCCACAAAAATCTGCATTGAAAGGGGCCAGGAGAAAGG
TTGGCTGAAGGAAGTAGTTGATGCCACAGATCAGCAAACTGATGCAAATGGATCACGCCT
ATTTGCAGAAAATTCAGCGCTTCATATGAAGTTCTTTGAGGAAGCCTTGCATTTAATTGA
CAAACGCCTCCAACAAGGTATCGACATGCTTCTAAACTCAGAAAGTGGATGTGTTGAAGC
AGCAAAGACGGGCTATATTTCCCCAAAGCTCTATGAACTCATCCAGATCTTTCACTCTTT
TAGTAACTCTCGTCATGCTCGATGCCTCATTTTTGTTGATCGAAAGATCACTGCTAGAGT
CATTGACCGGATGATTAAGAAAATTGGCCACCTTGCACATTTCACAGTTTCTTTTCTTAC
TGGAGGGAGATCTTCGGTGGATGCTCTGACACCCAAAATGCAGAAGGATACATTGGATTC
ATTTCGCTCTGGAAAGGTGAACTTACTATTTACTACAGATGTTGCTGAAGAGGGTATCCA
TGTCCCAGAATGCTCTTGTGTAATACGATTTGATTTGCCAAGGACAACACGTAGCTATGT
GCAGTCACGTGGACGAGCACGCCAGGAAGACTCTCAGTACATTCTCATGATTGAACGGGG
GAACGTGAAGCAAAATGATTTGATATCTGCAATTGTGAGAAGTGAGACTTCAATGGTTAA
GATTGCTTCAAGCAGAGAGTCTGGAAATCTGTCGCCTGGTTTTGTTCCCAATGAAGAAAT
AAACGAATACCATGTAGGCACAACAGGAGCGAAAGTAACTGCTGATTCAAGCATCAGTAT
TGTCTACCGATACTGTGAGAAGCTTCCGCAGGATAAGTGCTACTCCCCAAAACCTACATT
TGAGTTCACTCATCATGATGATGGATATGTGTGTACATTAGCATTACCACCAAGTGCTGT
GCTTCAAATTCTGGTGGGCCCAAAAGCAAGAAACATGCACAAAGCAAAACAGCTCGTTTG
CCTTGATGCATGTAAGAAGTTGCATGAGCTAGGAGCACTTGATGACCACCTTTGTCTATC
TGTTGAAGATCCAGTTCCAGAAATTGTAAGCAAAAATAAGGGTACTGGTATAGGTACAAC
CAAACGGAAGGAGCTACATGGTACAACAAGAATTCATGCTTGGTCTGGCAATTGGGTGTC
AAAGAAAACTGCACTCAAGCTTCAAAGCTACAAAATGAATTTTGTTTGTGACCAAGCTGG
TCAGATTTACTCTGAATTTGTTCTGTTAATTGATGCAACTTTACCGGATGAAGTCGCTAC
TTTGGAGATTGACCTATATTTGCACGACAAGATGGTCAAAACTTCAGTTTCTTCTTGTGG
ACTTCTTGAGTTGGATGCTCAACAGATGGAACAAGCAAAGTTGTTTCAAGGGCTTCTCTT
CAATGGTTTGTTTGGAAAGCTGTTTACTAGATCAAAAGTACCTAATGCTCCGAGGGAATT
CATTCTTAATAAAGAGGATACATTTGTGTGGAACACTGCGAGTGTATATTTGCTTTTACC
AACAAATCCTTCTTTTGACTCCAACGTTTGTATTAATTGGAGTGTCATTGATGCGGCAGC
TACGGCAGTTAAACTTATGAGAAGGATTTATTCTGAGAATAAAAGAGAATTACTTGGAAT
ATTTGATTCTGACCAAAATGTTGGAGATTTAATTCATTTAGCTAACAAGTCGTGTAAGGC
TAACAGCCTCAAAGATATGGTAGTTCTAGCAGTTCACACTGGGAAGATATATACTGCTCT
TGATATTACTGAATTATCTGGCGATAGCGCTTTTGATGGTGCATCTGATAAGAAAGAATG
TAAATTCCGGACATTCGCAGAATATTTCAAAAAGAAGTATGGCATAGTACTTCGCCACCC
CTCACAGCCACTACTAGTTTTGAAGCCTAGTCATAATCCTCACAACCTTCTTTCCTCGAA
GTTCAGGGATGAAGGTAATGTTGTGGAGAATATGAGTAATGGCACACCAGTTGTAAATAA
AACAAGCAACCGTGTCCACATGCCTCCTGAGTTGCTGATTCCCCTTGATTTACCTGTGGA
AATTTTGAGATCATTCTATTTGTTTCCGGCTTTGATGTATCGGATTGAGTCATTAACGTT
AGCTAGTCAACTAAGAAGTGAAATTGGATACAGCGATTCTAATATATCAAGTTTCCTGAT
TCTGGAAGCTATTACAACGCTTAGGTGCTCTGAGGATTTCTCTATGGAGCGTCTAGAATT
ATTGGGAGACTCTGTATTGAAGTATGCAGTGAGTTGTCATCTTTTCCTGAAATTTCCTAA
TAAGGATGAGGGGCAGCTATCATCCATAAGGTGCCATATGATTTGTAATGCCACACTTTA
TAAGCTTGGAATTGAACGCAATGTACAGGGTTACGTACGTGATGCTGCATTTGATCCTCG
TCGATGGCTAGCACCAGGACAGCTCTCTATTCGTCCATCTCCTTGTGAATGCCCTGTAAA
ATCTGAGGTTGTAACTGACGATATTCATATCATTGATGACAAGGCTATTGTTCTAGGCAA
GGCGTGTGACAAGGGACACAGATGGATGTGTTCCAAAACCATTGCTGATTGTGTTGAGGC
TATTATTGGGGCATATTATGCAGGGGGTGGTTTAAGAGCAGCCATGGCAGTTCTCAAATG
GTTGGGCATCGGGGCTGAAATTGAAGAAGACTTGATTGTGCAGGCCATATTGAGTGCTTC
TGTGCAGACTTATCTTCCAAAAGACAATGTATTTGAAATGCTTGAAGCAAAACTAGGCTA
TTCTTTCTCGGTGAAAGGTCTTTTGGTAGAGGCTCTGACTCACCCATCACAGCAGGAGTT
AGGTGCAAAATACTGCTACGAGCGCCTAGAGTTCCTCGGTGATGCGGTCTTAGACATTCT
GTTAACAAGATATCTTTTCAATAGTCATAAAGACACTAATGAGGGGGAGTTGACAGACTT
ACGTTCTGCATCAGTCAATAATGAAAACTTTGCACAAGTTGCAGTAAAGCACAACTTCCA
TCACTTTCTCCAGCATTCTTCTGGGCTTCTGTTAGACCAAATTACTGAATATGTGAATAG
GTTGGAAGGTTCATCCATGGACAAAGTTGAACTGTTATCAGATGGACTCCCAAAAGGGCC
TAAAGTCCTTGGTGATATTGTAGAAAGTATTGCAGGTGCAATTCTTTTAGACACCAAACT
TGATTTGGATGTAGTCTGGGGTATTTTTGAACCCCTTCTTTCCCCAATTGTCACACCTGA
GAATCTGGAGTTACCTCCATACAGAGAGCTTATCGAATGGTGTGGCAAACATGGGTATTT
TGTAGGAATTAACTGTAGAGATCAAGGAGACACAGTAGTGGCTACTCTTGATGTACAGCT
CAAAGAGGTGCTTCTTGTGAGGCAAGGTTTTAGCAAGAAAAGAAAAGATGCGAAAGCGCA
TGCATCTTCCTTACTGCTCAAAGATCTCGAGGAAAAAGGACTAATAATCCCAAAGAATGC
AAGCAAGACAGAACAATTTGAAAAGCATTGTGGCAGCACTAATCCCTTCAACAATTTGCA
TGTCGATGCAATGGATACACAGACTCCAAAACCAACCAAGGAAAAAAACGCAGCTGATTC
AAGGAACATTTCTGATCCCCTGCTTGGTAAACCATTGCACGTGATTGTGAAAACGAGTAA
AGGAGGACCACGCATTGCATTATATGAGTTGTGTAAAAAGTTGCAATGGCCAATGCCTAC
AATGGAATCTGAGAAAGTACAACCAAGCTTTAGCAGCGTGTGCTCCTCCCCTGGTGGTTC
CTCTCAGAAAGCTACCCCCCAAGCGTTCGCTTTCGCTTCAACCATTACATTGCATATACC
AAATGCTGATGTGATCAGCCTCACAGGAGATGGCCGTGCAGATAAGAAGAGCTCACAGGA
TTCTGCTGCCCTGTTCTTGCTCTATGAGCTTCAGCGGCGAGGTACTTTGCAACTCCAGGA
GGTGTGAAGGAACGACAACTGATTGCTTGCCAACCAGTTGCTTGGAAGTTGGAATAATAG
ACCAACCAGTTGCTTGCCACCACTCAGCTTTGTACATCTTCTCCAGTGTTCACCTTCTGA
ATTATGATAAGAGGGTACCCAAAGAATGGAGAACAGCTGACCTGGTTCTGGTGTGTGTCA
GTTGTTATGTGTGTTTGTCCATATGTTATCTGCGTAGAAACTGAATAAGCCCCCAAAGTT
GTTGCTGACGATAAACACGCAAATATCATGCCCCTGTAGCCTGTAGGTGTTAAACCAATT
GTTCAAGGATAAAAAGAGAGACCATTTTCAAATCATGTTTCCTTGTTCTATTATTACATA
AACATACCGGACTTTTTTTCTTATAAAAACTACTCCAGTAAACATTTGATC

CDS

4956 bp

>Os01t0909200-01 Dicer-like 3 homolog, 24-nt siRNA processing, Control of agricultural trait
ATGAACCCTTTAAAGAGGTCATTGGAATCATCTTCTCAGGAACATGAAGCAGGCAAACAG
AAACTGCAGAAGAGAGAGTGTCAAGATTTCACTCCCAGAAGATATCAGCTTGATGTCTAT
GAGGTTGCAATGCGGAGAAACACGATTGCGATGCTTGACACAGGAGCCGGGAAGACAATG
ATTGCTGTGATGCTTATCAAGGAGTTCGGAAAGATAAACAGAACAAAGAATGCTGGAAAA
GTCATCATATTTCTTGCACCAACAGTTCAACTTGTTACACAGCAATGCGAGGTGATTGAA
ATCCACACAGATTTTGAGGTAGAACAATACTATGGTGCAAAGGGGGTTGATCAATGGACA
GGTCCTAGATGGCAAGAGCAAATCTCAAAATACCAGGTCATGGTCATGACACCACAGGTG
TTCCTACAAGCTTTACGCAATGCTTTCTTAATCTTGGACATGGTTAGTCTCATGATATTT
GATGAATGCCATCATGCAACTGGAAACCACCCTTATACAAGAATAATGAAGGAGTTCTAT
CACAAATCAGAACATAAGCCAAGTGTGTTTGGTATGACAGCATCACCTGTTATAAGAAAA
GGTATCTCTTCTCATTTGGATTGTGAAGGTCAGTTCTGTGAATTGGAGAACCTGTTAGAT
GCTAAGATCTACACAGTTTCAGATAGAGAAGAGATAGAGTTTTGTGTTCCTTCTGCAAAA
GAAATGTGCAGGTACTATGACTCGAAACCAGTTTGTTTTGAAGATTTGAGTGAAGAATTG
GGAGTTTTATGTTCCAAGTATGATGCATTGATAACAGAGTTGCAGAATAAGCGAAGCGAC
ATGTATAAAGATGCTGATGATATAACAAAAGAATCAAAGAGACGCCTTTCTAAATCTATA
GCAAAAATTTGCTACTGCCTTGATGATGTTGGTCTTATTTGTGCAAGTGAGGCCACAAAA
ATCTGCATTGAAAGGGGCCAGGAGAAAGGTTGGCTGAAGGAAGTAGTTGATGCCACAGAT
CAGCAAACTGATGCAAATGGATCACGCCTATTTGCAGAAAATTCAGCGCTTCATATGAAG
TTCTTTGAGGAAGCCTTGCATTTAATTGACAAACGCCTCCAACAAGGTATCGACATGCTT
CTAAACTCAGAAAGTGGATGTGTTGAAGCAGCAAAGACGGGCTATATTTCCCCAAAGCTC
TATGAACTCATCCAGATCTTTCACTCTTTTAGTAACTCTCGTCATGCTCGATGCCTCATT
TTTGTTGATCGAAAGATCACTGCTAGAGTCATTGACCGGATGATTAAGAAAATTGGCCAC
CTTGCACATTTCACAGTTTCTTTTCTTACTGGAGGGAGATCTTCGGTGGATGCTCTGACA
CCCAAAATGCAGAAGGATACATTGGATTCATTTCGCTCTGGAAAGGTGAACTTACTATTT
ACTACAGATGTTGCTGAAGAGGGTATCCATGTCCCAGAATGCTCTTGTGTAATACGATTT
GATTTGCCAAGGACAACACGTAGCTATGTGCAGTCACGTGGACGAGCACGCCAGGAAGAC
TCTCAGTACATTCTCATGATTGAACGGGGGAACGTGAAGCAAAATGATTTGATATCTGCA
ATTGTGAGAAGTGAGACTTCAATGGTTAAGATTGCTTCAAGCAGAGAGTCTGGAAATCTG
TCGCCTGGTTTTGTTCCCAATGAAGAAATAAACGAATACCATGTAGGCACAACAGGAGCG
AAAGTAACTGCTGATTCAAGCATCAGTATTGTCTACCGATACTGTGAGAAGCTTCCGCAG
GATAAGTGCTACTCCCCAAAACCTACATTTGAGTTCACTCATCATGATGATGGATATGTG
TGTACATTAGCATTACCACCAAGTGCTGTGCTTCAAATTCTGGTGGGCCCAAAAGCAAGA
AACATGCACAAAGCAAAACAGCTCGTTTGCCTTGATGCATGTAAGAAGTTGCATGAGCTA
GGAGCACTTGATGACCACCTTTGTCTATCTGTTGAAGATCCAGTTCCAGAAATTGTAAGC
AAAAATAAGGGTACTGGTATAGGTACAACCAAACGGAAGGAGCTACATGGTACAACAAGA
ATTCATGCTTGGTCTGGCAATTGGGTGTCAAAGAAAACTGCACTCAAGCTTCAAAGCTAC
AAAATGAATTTTGTTTGTGACCAAGCTGGTCAGATTTACTCTGAATTTGTTCTGTTAATT
GATGCAACTTTACCGGATGAAGTCGCTACTTTGGAGATTGACCTATATTTGCACGACAAG
ATGGTCAAAACTTCAGTTTCTTCTTGTGGACTTCTTGAGTTGGATGCTCAACAGATGGAA
CAAGCAAAGTTGTTTCAAGGGCTTCTCTTCAATGGTTTGTTTGGAAAGCTGTTTACTAGA
TCAAAAGTACCTAATGCTCCGAGGGAATTCATTCTTAATAAAGAGGATACATTTGTGTGG
AACACTGCGAGTGTATATTTGCTTTTACCAACAAATCCTTCTTTTGACTCCAACGTTTGT
ATTAATTGGAGTGTCATTGATGCGGCAGCTACGGCAGTTAAACTTATGAGAAGGATTTAT
TCTGAGAATAAAAGAGAATTACTTGGAATATTTGATTCTGACCAAAATGTTGGAGATTTA
ATTCATTTAGCTAACAAGTCGTGTAAGGCTAACAGCCTCAAAGATATGGTAGTTCTAGCA
GTTCACACTGGGAAGATATATACTGCTCTTGATATTACTGAATTATCTGGCGATAGCGCT
TTTGATGGTGCATCTGATAAGAAAGAATGTAAATTCCGGACATTCGCAGAATATTTCAAA
AAGAAGTATGGCATAGTACTTCGCCACCCCTCACAGCCACTACTAGTTTTGAAGCCTAGT
CATAATCCTCACAACCTTCTTTCCTCGAAGTTCAGGGATGAAGGTAATGTTGTGGAGAAT
ATGAGTAATGGCACACCAGTTGTAAATAAAACAAGCAACCGTGTCCACATGCCTCCTGAG
TTGCTGATTCCCCTTGATTTACCTGTGGAAATTTTGAGATCATTCTATTTGTTTCCGGCT
TTGATGTATCGGATTGAGTCATTAACGTTAGCTAGTCAACTAAGAAGTGAAATTGGATAC
AGCGATTCTAATATATCAAGTTTCCTGATTCTGGAAGCTATTACAACGCTTAGGTGCTCT
GAGGATTTCTCTATGGAGCGTCTAGAATTATTGGGAGACTCTGTATTGAAGTATGCAGTG
AGTTGTCATCTTTTCCTGAAATTTCCTAATAAGGATGAGGGGCAGCTATCATCCATAAGG
TGCCATATGATTTGTAATGCCACACTTTATAAGCTTGGAATTGAACGCAATGTACAGGGT
TACGTACGTGATGCTGCATTTGATCCTCGTCGATGGCTAGCACCAGGACAGCTCTCTATT
CGTCCATCTCCTTGTGAATGCCCTGTAAAATCTGAGGTTGTAACTGACGATATTCATATC
ATTGATGACAAGGCTATTGTTCTAGGCAAGGCGTGTGACAAGGGACACAGATGGATGTGT
TCCAAAACCATTGCTGATTGTGTTGAGGCTATTATTGGGGCATATTATGCAGGGGGTGGT
TTAAGAGCAGCCATGGCAGTTCTCAAATGGTTGGGCATCGGGGCTGAAATTGAAGAAGAC
TTGATTGTGCAGGCCATATTGAGTGCTTCTGTGCAGACTTATCTTCCAAAAGACAATGTA
TTTGAAATGCTTGAAGCAAAACTAGGCTATTCTTTCTCGGTGAAAGGTCTTTTGGTAGAG
GCTCTGACTCACCCATCACAGCAGGAGTTAGGTGCAAAATACTGCTACGAGCGCCTAGAG
TTCCTCGGTGATGCGGTCTTAGACATTCTGTTAACAAGATATCTTTTCAATAGTCATAAA
GACACTAATGAGGGGGAGTTGACAGACTTACGTTCTGCATCAGTCAATAATGAAAACTTT
GCACAAGTTGCAGTAAAGCACAACTTCCATCACTTTCTCCAGCATTCTTCTGGGCTTCTG
TTAGACCAAATTACTGAATATGTGAATAGGTTGGAAGGTTCATCCATGGACAAAGTTGAA
CTGTTATCAGATGGACTCCCAAAAGGGCCTAAAGTCCTTGGTGATATTGTAGAAAGTATT
GCAGGTGCAATTCTTTTAGACACCAAACTTGATTTGGATGTAGTCTGGGGTATTTTTGAA
CCCCTTCTTTCCCCAATTGTCACACCTGAGAATCTGGAGTTACCTCCATACAGAGAGCTT
ATCGAATGGTGTGGCAAACATGGGTATTTTGTAGGAATTAACTGTAGAGATCAAGGAGAC
ACAGTAGTGGCTACTCTTGATGTACAGCTCAAAGAGGTGCTTCTTGTGAGGCAAGGTTTT
AGCAAGAAAAGAAAAGATGCGAAAGCGCATGCATCTTCCTTACTGCTCAAAGATCTCGAG
GAAAAAGGACTAATAATCCCAAAGAATGCAAGCAAGACAGAACAATTTGAAAAGCATTGT
GGCAGCACTAATCCCTTCAACAATTTGCATGTCGATGCAATGGATACACAGACTCCAAAA
CCAACCAAGGAAAAAAACGCAGCTGATTCAAGGAACATTTCTGATCCCCTGCTTGGTAAA
CCATTGCACGTGATTGTGAAAACGAGTAAAGGAGGACCACGCATTGCATTATATGAGTTG
TGTAAAAAGTTGCAATGGCCAATGCCTACAATGGAATCTGAGAAAGTACAACCAAGCTTT
AGCAGCGTGTGCTCCTCCCCTGGTGGTTCCTCTCAGAAAGCTACCCCCCAAGCGTTCGCT
TTCGCTTCAACCATTACATTGCATATACCAAATGCTGATGTGATCAGCCTCACAGGAGAT
GGCCGTGCAGATAAGAAGAGCTCACAGGATTCTGCTGCCCTGTTCTTGCTCTATGAGCTT
CAGCGGCGAGGTACTTTGCAACTCCAGGAGGTGTGA

Protein

1652 aa

>Os01t0909200-01 Dicer-like 3 homolog, 24-nt siRNA processing, Control of agricultural trait
MNPLKRSLESSSQEHEAGKQKLQKRECQDFTPRRYQLDVYEVAMRRNTIAMLDTGAGKTM
IAVMLIKEFGKINRTKNAGKVIIFLAPTVQLVTQQCEVIEIHTDFEVEQYYGAKGVDQWT
GPRWQEQISKYQVMVMTPQVFLQALRNAFLILDMVSLMIFDECHHATGNHPYTRIMKEFY
HKSEHKPSVFGMTASPVIRKGISSHLDCEGQFCELENLLDAKIYTVSDREEIEFCVPSAK
EMCRYYDSKPVCFEDLSEELGVLCSKYDALITELQNKRSDMYKDADDITKESKRRLSKSI
AKICYCLDDVGLICASEATKICIERGQEKGWLKEVVDATDQQTDANGSRLFAENSALHMK
FFEEALHLIDKRLQQGIDMLLNSESGCVEAAKTGYISPKLYELIQIFHSFSNSRHARCLI
FVDRKITARVIDRMIKKIGHLAHFTVSFLTGGRSSVDALTPKMQKDTLDSFRSGKVNLLF
TTDVAEEGIHVPECSCVIRFDLPRTTRSYVQSRGRARQEDSQYILMIERGNVKQNDLISA
IVRSETSMVKIASSRESGNLSPGFVPNEEINEYHVGTTGAKVTADSSISIVYRYCEKLPQ
DKCYSPKPTFEFTHHDDGYVCTLALPPSAVLQILVGPKARNMHKAKQLVCLDACKKLHEL
GALDDHLCLSVEDPVPEIVSKNKGTGIGTTKRKELHGTTRIHAWSGNWVSKKTALKLQSY
KMNFVCDQAGQIYSEFVLLIDATLPDEVATLEIDLYLHDKMVKTSVSSCGLLELDAQQME
QAKLFQGLLFNGLFGKLFTRSKVPNAPREFILNKEDTFVWNTASVYLLLPTNPSFDSNVC
INWSVIDAAATAVKLMRRIYSENKRELLGIFDSDQNVGDLIHLANKSCKANSLKDMVVLA
VHTGKIYTALDITELSGDSAFDGASDKKECKFRTFAEYFKKKYGIVLRHPSQPLLVLKPS
HNPHNLLSSKFRDEGNVVENMSNGTPVVNKTSNRVHMPPELLIPLDLPVEILRSFYLFPA
LMYRIESLTLASQLRSEIGYSDSNISSFLILEAITTLRCSEDFSMERLELLGDSVLKYAV
SCHLFLKFPNKDEGQLSSIRCHMICNATLYKLGIERNVQGYVRDAAFDPRRWLAPGQLSI
RPSPCECPVKSEVVTDDIHIIDDKAIVLGKACDKGHRWMCSKTIADCVEAIIGAYYAGGG
LRAAMAVLKWLGIGAEIEEDLIVQAILSASVQTYLPKDNVFEMLEAKLGYSFSVKGLLVE
ALTHPSQQELGAKYCYERLEFLGDAVLDILLTRYLFNSHKDTNEGELTDLRSASVNNENF
AQVAVKHNFHHFLQHSSGLLLDQITEYVNRLEGSSMDKVELLSDGLPKGPKVLGDIVESI
AGAILLDTKLDLDVVWGIFEPLLSPIVTPENLELPPYRELIEWCGKHGYFVGINCRDQGD
TVVATLDVQLKEVLLVRQGFSKKRKDAKAHASSLLLKDLEEKGLIIPKNASKTEQFEKHC
GSTNPFNNLHVDAMDTQTPKPTKEKNAADSRNISDPLLGKPLHVIVKTSKGGPRIALYEL
CKKLQWPMPTMESEKVQPSFSSVCSSPGGSSQKATPQAFAFASTITLHIPNADVISLTGD
GRADKKSSQDSAALFLLYELQRRGTLQLQEV*

5'UTR

chr01:39606082..39606227 (- strand) : 146 bp

chr01:39605706..39605710 (- strand) : 5 bp

CDS

chr01:39605605..39605705 (- strand) : 101 bp

chr01:39605328..39605508 (- strand) : 181 bp

chr01:39605138..39605252 (- strand) : 115 bp

chr01:39604426..39604559 (- strand) : 134 bp

chr01:39604252..39604322 (- strand) : 71 bp

chr01:39603861..39603924 (- strand) : 64 bp

chr01:39603404..39603535 (- strand) : 132 bp

chr01:39603145..39603297 (- strand) : 153 bp

chr01:39602688..39602862 (- strand) : 175 bp

chr01:39602269..39602374 (- strand) : 106 bp

chr01:39601990..39602182 (- strand) : 193 bp

chr01:39601748..39601908 (- strand) : 161 bp

chr01:39601413..39601631 (- strand) : 219 bp

chr01:39601007..39601263 (- strand) : 257 bp

chr01:39599990..39600261 (- strand) : 272 bp

chr01:39599420..39599910 (- strand) : 491 bp

chr01:39599244..39599341 (- strand) : 98 bp

chr01:39598765..39598988 (- strand) : 224 bp

chr01:39598471..39598680 (- strand) : 210 bp

chr01:39597889..39598362 (- strand) : 474 bp

chr01:39597521..39597802 (- strand) : 282 bp

chr01:39596918..39597244 (- strand) : 327 bp

chr01:39596640..39596823 (- strand) : 184 bp

chr01:39596397..39596508 (- strand) : 112 bp

chr01:39596086..39596305 (- strand) : 220 bp

3'UTR

chr01:39595682..39596085 (- strand) : 404 bp

FASTA

>Os01t0909200-01 class=Sequence position=chr01:39595682..39606227 (- strand)
GTAGTGGCCT CTGTCGTCCG TGAGTTACCC TGACCCCTCC TCGTCAGTTT GCCCGCCGCG GCGCCGCCGC CGCCGCCGCC
GATCCCCATC CATCCCGCGA GCGAGCAGGG CGCCGTCGTT CGTCCTGCTG CATCCGCCGC ATCCTGGTGA GCACCTCCTC
CGCCACCGCC GCCTGCGTCG ATCCCCATCC ATCGCGCGCG CGAGCGAGCT GGGTCGCCGT CGTTCGTACT GCTGCTTCCG
CCGCTTCCGT TACGCACATC CTCTTTCTAC CCACGCACTT TTTCTCGGAT ttgcgttaat cctagcttct gttctagaaa
ctgacttaac cttagaaaat agtactaata acagttcaat ggttcccaaa aagtttgggg gtttaactga accccatgtc
ccatgttaga tccgccactg CTTCGAGGAT TACTAATTCC GTTCTATTTG GGTGTGAATA TTCTCAATGG TGAATTGTCA
TGACCTCACT TTGTAAATTT CTCTGTTGGA ATGGCAGTAA ACATGAACCC TTTAAAGAGG TCATTGGAAT CATCTTCTCA
GGAACATGAA GCAGGCAAAC AGAAACTGCA GAAGAGAGAG TGTCAAGATT TCACTCCCAG AAGGTTCTGC GGAGTTCTCC
TTTTCACAGT TACTATATTA TATAATCAGA AAAAGAGTGC AATCCTGTGA CATTGCTTTG TGATGCTGAA ATTGGTCAGA
TATCAGCTTG ATGTCTATGA GGTTGCAATG CGGAGAAACA CGATTGCGAT GCTTGACACA GGAGCCGGGA AGACAATGAT
TGCTGTGATG CTTATCAAGG AGTTCGGAAA GATAAACAGA ACAAAGAATG CTGGAAAAGT CATCATATTT CTTGCACCAA
CAGTTCAACT TGTTACACAG GTTATACCAG TCTGTAGACT GTTCGTTTTA TCCTAACTGT AATGTAATTT ATACTAACAT
TATTTTTTGC CACAGCAATG CGAGGTGATT GAAATCCACA CAGATTTTGA GGTAGAACAA TACTATGGTG CAAAGGGGGT
TGATCAATGG ACAGGTCCTA GATGGCAAGA GCAAATCTCA AAATACCAGG CAAGCATTTA TTTGTTGTTG TTTTAAAGGC
TCACTGATTC ATCATATGTG CTAAAGAAAA TACTCATTCC ATGCTAGCAG CACTTATGAT CTGCAGTCTT CTGTTCACTA
TATTATAGAG TAAATTtcac gaaactacag atttttaacc aaattatcgc aaaactacag atttaaggcc aagtattaga
gaactacaga tttaatacta aagttatcac aaaacaacat attctagagt ataaatctat agcactaccg ttacgttaga
gctataaaca ttgtagtttt gtgcttaaaa ttggcactaa acctgtagtt ttgtggtaaa tttgctactt aatctttatc
tttgtgatac tctatcttaa atctgtagtt ctatgagaaa ttccatgcta aatctgtagt tttgtgatat aacacctaaa
ctctgtagtt ttgtgacagt ttgatcgaag tatccatagt tttgtgaaat ttactcAACA TCTTTTGTTA AGAATATCCC
ATAGATGTTT TTCCCCTGTT CTATCTACTT GTTGATGCTT TCAACACTTA TAATAATAAA ATTGCAGGTC ATGGTCATGA
CACCACAGGT GTTCCTACAA GCTTTACGCA ATGCTTTCTT AATCTTGGAC ATGGTTAGTC TCATGATATT TGATGAATGC
CATCATGCAA CTGGAAACCA CCCTTATACA AGAATAATGA AGGTATTGTG AAATACCATC TTATCATGTT TTTTTTTTTT
TGACATTAGC ATTTAGGTTT TTCTTTTTTG TGTTTGTCAT ATGTTATAAC TCATCACTAT CTCAGGAGTT CTATCACAAA
TCAGAACATA AGCCAAGTGT GTTTGGTATG ACAGCATCAC CTGTTATAAG AAAAGGCAAG TATTCAGTTA TCTGCAAGAG
CTATAGAATG CTTCTTCTTC TTTTCTTTTG TGTGGGTGTG GGTGGGGGGA GGAATGGGAT GTTAAGAGAC TTATAAGTCA
GAAAAGATCA GCAATAAATT TCTTGTAAAC AGTGGCATTT AGGACATGTG TTAATTCTGA CCTGCCATCT AAGAGAAATA
TCCAGGAATA ATGATCGTGC GCATAATCTC CAATTTCACT TTGGCCATAG AGTTCATAAA TGCCAATATT TCTGGCAGAT
TTGATTTATT CGCATCACTT AGTCTTATTA GATGATTTGA GTTTTCATGG TTTTCTTTGC AGGTATCTCT TCTCATTTGG
ATTGTGAAGG TCAGTTCTGT GAATTGGAGA ACCTGTTAGA TGCTAAGGTA TGTTCAGTTT CCTGCTTTGC CACACATATT
ATTTGAATAA GCTGGGTTAG ATTATACAGG ACATGTTAGT TCTGATAACT ACACTATTCT ACTTTGTCTA TTGAAGTGCA
AGGATATATA CATACCTGAA TTCCAATTAT TTACTGATTG TGGTTTTCAA CCAAATGCAA ATTGTTTTAC TGTTGTGTTC
GTTTTGAGAG CTTAGGTGAT ATATATTTAT CTGTTTTACC CATGCCATTT TGGGATACAC CTATGACCCC TTTTAAAAAT
GTGATACGGT TATCTGCGTA CTTTGATTCT CATTAATTTT TATCTGTAAC AGATCTACAC AGTTTCAGAT AGAGAAGAGA
TAGAGTTTTG TGTTCCTTCT GCAAAAGAAA TGTGCAGGTA CTATGACTCG AAACCAGTTT GTTTTGAAGA TTTGAGTGAA
GAATTGGGAG TTTTATGTTC CAAGGTTTTA TATCTCTTTT TTCTCTTCTA TATTGATCAA ATTTGTCATC AAAGTTTGCA
GCTCAGCATT TTTAATGTTT CTAAGAACAC ACTCTTTTAT GTATGTGCAG TATGATGCAT TGATAACAGA GTTGCAGAAT
AAGCGAAGCG ACATGTATAA AGATGCTGAT GATATAACAA AAGAATCAAA GAGACGCCTT TCTAAATCTA TAGCAAAAAT
TTGCTACTGC CTTGATGATG TTGGTCTTAT TTGTGCAAGT GAGGTATTTG TTATATTCAT TTGTTCTAGC TACTTATGTT
ACAGGAACTG AGCTTAACTT GGTGCGAAGC GCGTTTGCAC GCCTCACAAC CTATTTAAAT CCTTTTCAGC CTAATTTTGG
GTTACTTTCT TCTTAACCAA AAAAATCCCA TCTCTTAGTA ATTCTTTTTT CTCTCTCATA CTGCAACGTT AGCTTTCTAT
GTTTGAAGAG TTCTTTTACC GTCACTTTGC TTCAGAGTTC ATGTCTTAAT ATGGGTAAAT AATAACTTAT CATTCATTCT
CTTAGGCCAC AAAAATCTGC ATTGAAAGGG GCCAGGAGAA AGGTTGGCTG AAGGAAGTAG TTGATGCCAC AGATCAGCAA
ACTGATGCAA ATGGATCACG CCTATTTGCA GAAAATTCAG CGCTTCATAT GAAGTTCTTT GAGGAAGCCT TGCATTTAAT
TGACAAACGC CTCCAACAAG GTATGACTAT GTAGATAAAC TAATAATGGA CTGGTAATGT CTGTAAACTT ATTTGCAACC
TTACACTGTT ATGCCATGCC ATTAGCCAAT GGATCTAAGC ATATATAGCA CTGCAACACC CTATATGAAC TTATGGAGTA
TGATGAATCT GTTTGATAGG AAGTATCATG TACCATCTCC TTGATGAATT CCTATCCTTT CATTTGATGT CTGTGTGTAG
CATGAAGATG GTACTTCAGT CTTTTGGCTC TCTTCTCAAT ATGAAAATGC TCAGTCCTTC TGTGTATTCT CTAAACTATT
TGCTATCTTC CAGGTATCGA CATGCTTCTA AACTCAGAAA GTGGATGTGT TGAAGCAGCA AAGACGGGCT ATATTTCCCC
AAAGCTCTAT GAACTCATCC AGATCTTTCA CTCTTTTAGG TATTATTTCT TGGGGAAGGT CCACTTGTTT ATTTTTTTCA
ATTGTGTGCC TTTAAACTGA CGTGACACAT TTCTATTCCT AACAGTAACT CTCGTCATGC TCGATGCCTC ATTTTTGTTG
ATCGAAAGAT CACTGCTAGA GTCATTGACC GGATGATTAA GAAAATTGGC CACCTTGCAC ATTTCACAGT TTCTTTTCTT
ACTGGAGGGA GATCTTCGGT GGATGCTCTG ACACCCAAAA TGCAGAAGGA TACATTGGAT TCATTTCGCT CTGGAAAGGT
AATTAAGATA TGTCAACACT TGGAGAAACT GAAGCATAGT TCTCATGATA TAACCTTGTT TTCCCTTTCT AAAATGCAGG
TGAACTTACT ATTTACTACA GATGTTGCTG AAGAGGGTAT CCATGTCCCA GAATGCTCTT GTGTAATACG ATTTGATTTG
CCAAGGACAA CACGTAGCTA TGTGCAGTCA CGTGGACGAG CACGCCAGGA AGACTCTCAG TACATTCTCA TGATTGAACG
GTATAACCTT AATGCTACCC CATTACACCT TTTATTCACG TGCTTTTAAC TGAATGCAGA GAGGAATGGC AAACAAGAAG
GATGCAAGGA TACATAATTC ATTTCTTCTA ATGCAGGGGG AACGTGAAGC AAAATGATTT GATATCTGCA ATTGTGAGAA
GTGAGACTTC AATGGTTAAG ATTGCTTCAA GCAGAGAGTC TGGAAATCTG TCGCCTGGTT TTGTTCCCAA TGAAGAAATA
AACGAATACC ATGTAGGCAC AACAGGAGCG AAAGTAACTG CTGATTCAAG CATCAGTATT GTCTACCGAT ACTGTGAGAA
GCTTCCGCAG GATAAGTATG TTGATCTCAT TTTCAGTTGT CTCTTTTTAC ATGACTACAC AGATTGCACC TATAAATAGA
TCTGCAATAC CTGGTTTCAG TCTGTTATCG TTTTTGTTTG GAGACCTCCA ATTCACTTTC TTGCCATTTC TGCTTGTGTT
ACAGGTGCTA CTCCCCAAAA CCTACATTTG AGTTCACTCA TCATGATGAT GGATATGTGT GTACATTAGC ATTACCACCA
AGTGCTGTGC TTCAAATTCT GGTGGGCCCA AAAGCAAGAA ACATGCACAA AGCAAAACAG CTCGTTTGCC TTGATGCATG
TAAGAAGTTG CATGAGCTAG GAGCACTTGA TGACCACCTT TGTCTATCTG TTGAAGATCC AGTTCCAGAA ATTGTAAGCA
AAAATAAGGG TACTGGTATA GGTATGTGAT TGCCAAGTTT TATAAGGAGT AAATCGTATC ACTGGTCCTC TAACTTGAAC
TAATTGTTCA CCATCTGGGT TCCTGTACTT AGAAACTACA TATTTTAGTC CATAAAGTAC ATTAAGGTGG TCATTTTAGG
TCCATCTGGG TAACTAGCAT TCCTTGTGGA CATGATACAC TGAGGTGGAT CTGGCATCCT TGTGCCCCCC GGCCCCTCCC
CACAACCTCC AACCCTCCCA AAAAAAACTG TGCCACGAGT GCAACATCAC AAATGCTGTT TTTGTCAACT AGATGCTGCA
CCTAAGGTCA GCTGCATCTC TGGGAGCATG AGTGAACATC ACCTGCATGC TTCATCATCA CCTCATTAAG TTTCCATCTC
CATGAATTGT GTTGTTACTT GTGACATCCA CCGCAAAATA GTACAACAAT TTAGGGGAGA TATCTAAGGG AGAAGAGAGA
GGGACGGCCA CACATAAAAT GCCATTTCTT CTGGATTGTA TAGTTAATAA TCTACTTTAC GCACTTTTGG ACCTAGATTT
GCATTTTCTA CATATATGTA CCTAGATTAG TCCTGTGTAC AAGTTTAAGG ATTCGCCATG CAATTTACTC CAAGTTAAGA
TGCCATATGC TGGCTGGTTC TTTGTAACCA GCGTATGTAG TCAAGCTTAT TTGTAGGACT GAACTCCATT ATACTTCTTA
CAAAGAAATA GATGTCATGG TAATGTTCTC TATTACCTTC TTGAAGGTAC AACCAAACGG AAGGAGCTAC ATGGTACAAC
AAGAATTCAT GCTTGGTCTG GCAATTGGGT GTCAAAGAAA ACTGCACTCA AGCTTCAAAG CTACAAAATG AATTTTGTTT
GTGACCAAGC TGGTCAGATT TACTCTGAAT TTGTTCTGTT AATTGATGCA ACTTTACCGG ATGAAGTCGC TACTTTGGAG
ATTGACCTAT ATTTGCACGA CAAGATGGTC AAAACTTCAG TTTCTTCTTG TGGACTTCTT GAGTTGGATG CTCAACAGGT
ATGATGAAGT TTGTCCCCTA CTTTTGTTTT TTTCCCATTT AATCTGAAAA ATTCCTTATC CTTTTTTTTT GTCTCAGATG
GAACAAGCAA AGTTGTTTCA AGGGCTTCTC TTCAATGGTT TGTTTGGAAA GCTGTTTACT AGATCAAAAG TACCTAATGC
TCCGAGGGAA TTCATTCTTA ATAAAGAGGA TACATTTGTG TGGAACACTG CGAGTGTATA TTTGCTTTTA CCAACAAATC
CTTCTTTTGA CTCCAACGTT TGTATTAATT GGAGTGTCAT TGATGCGGCA GCTACGGCAG TTAAACTTAT GAGAAGGATT
TATTCTGAGA ATAAAAGAGA ATTACTTGGA ATATTTGATT CTGACCAAAA TGTTGGAGAT TTAATTCATT TAGCTAACAA
GTCGTGTAAG GCTAACAGCC TCAAAGATAT GGTAGTTCTA GCAGTTCACA CTGGGAAGAT ATATACTGCT CTTGATATTA
CTGAATTATC TGGCGATAGC GCTTTTGATG GTGCATCTGA TAAGAAAGAA TGTAAATTCC GGACATTCGC AGAATATTTC
AAAAAGAAGT GTGTATAGTT TTGTGCATGT CCATGTGCTT GCTCAGGTAT AATCTTGCTT TTTTTGTCTA ATATATTCGT
TTACAGGTAT GGCATAGTAC TTCGCCACCC CTCACAGCCA CTACTAGTTT TGAAGCCTAG TCATAATCCT CACAACCTTC
TTTCCTCGAA GTTCAGGGAT GAAGGTCTGT ATCTATTCTT CTATATAGTT AGTTTTGTTC TACCTTGTGT TTGTCTTCCC
TAACTGGTTA CTTATTAGTT TTTTCAAGCA AGATTAGTTT GAAGCATCTC TATTTTTTTA CTTCGATGAT TAGTGATAAA
CCCATTTGTT AGACTGGTTA CTTTTGCATA AACTGTTTTA TTTTTGTAAT TTGTAGCCAA GTTGATTATG TCGTATATAG
GCTGATCTAA TATTTATGAT TGCTGTTGCT TTTTTTTAGG TAATGTTGTG GAGAATATGA GTAATGGCAC ACCAGTTGTA
AATAAAACAA GCAACCGTGT CCACATGCCT CCTGAGTTGC TGATTCCCCT TGATTTACCT GTGGAAATTT TGAGATCATT
CTATTTGTTT CCGGCTTTGA TGTATCGGAT TGAGTCATTA ACGTTAGCTA GTCAACTAAG AAGTGAAATT GGATACAGCG
ATTCTAATAT ATCAAGTTTC CTGGTATAGA TGCTTATACC TCTCTCTTCT ATACATACAT TTTCTGTTTC TTTAATATGA
AATGATATAT TGGCACATGT TCTTTAGATT CTGGAAGCTA TTACAACGCT TAGGTGCTCT GAGGATTTCT CTATGGAGCG
TCTAGAATTA TTGGGAGACT CTGTATTGAA GTATGCAGTG AGTTGTCATC TTTTCCTGAA ATTTCCTAAT AAGGATGAGG
GGCAGCTATC ATCCATAAGG TGCCATATGA TTTGTAATGC CACACTTTAT AAGCTTGGAA TTGAACGCAA TGTACAGGTA
AATTCACATT ATCATTTGGC AGTGTCTAGA GATTTTGTAT TTCATGGACA CACTGAGCTT TAATTGTCTG AGCTAAGTTG
ACAATTGGTG GAATGTAATC AACAGGGTTA CGTACGTGAT GCTGCATTTG ATCCTCGTCG ATGGCTAGCA CCAGGACAGC
TCTCTATTCG TCCATCTCCT TGTGAATGCC CTGTAAAATC TGAGGTTGTA ACTGACGATA TTCATATCAT TGATGACAAG
GCTATTGTTC TAGGCAAGGC GTGTGACAAG GGACACAGAT GGATGTGTTC CAAAACCATT GCTGATTGTG TTGAGGCTAT
TATTGGGGCA TATTATGCAG GGGGTGGTTT AAGAGCAGCC ATGGCAGTTC TCAAATGGTT GGGCATCGGG GCTGAAATTG
AAGAAGACTT GATTGTGCAG GCCATATTGA GTGCTTCTGT GCAGACTTAT CTTCCAAAAG ACAATGTATT TGAAATGCTT
GAAGCAAAAC TAGGCTATTC TTTCTCGGTG AAAGGTCTTT TGGTAGAGGC TCTGACTCAC CCATCACAGC AGGAGTTAGG
TGCAAAATAC TGCTACGAGG TATCGGGTGA ACATAAAACT ATTTTGCTGG TCCTTCATAT TGTGTCTTAA CTTACCCAAC
TTCTCTAATG TTTTTTTTTT AACAGCGCCT AGAGTTCCTC GGTGATGCGG TCTTAGACAT TCTGTTAACA AGATATCTTT
TCAATAGTCA TAAAGACACT AATGAGGGGG AGTTGACAGA CTTACGTTCT GCATCAGTCA ATAATGAAAA CTTTGCACAA
GTTGCAGTAA AGCACAACTT CCATCACTTT CTCCAGCATT CTTCTGGGCT TCTGTTAGAC CAAATTACTG AATATGTGAA
TAGGTTGGAA GGTTCATCCA TGGACAAAGT TGAACTGTTA TCAGATGGAC TCCCAAAAGG GCCTAAAGTA CGTTCTTTCT
TTGTTTTAAC ATGTGTGTGG TTTGCTCTTA TCAGAATAAA ATCAAGTCAA TACGTTAGGA TTTCAGTTCA TATGAATGAC
ATTTGCTTTA AGTTAGAGCA TCTTATAAAT GCATGGCTAT GTATTTAATA TACTTTTTAC AAGTTATTTG CATTGCATTA
CCTGTGTCCT TTTTAGTGTC ATCTTCCAGT ATTGACATAC ACAATCATCT TTACAATTTA TCTATATTAA TATATCATAT
TTCACTTGTC TATTGTGATA CAGGTCCTTG GTGATATTGT AGAAAGTATT GCAGGTGCAA TTCTTTTAGA CACCAAACTT
GATTTGGATG TAGTCTGGGG TATTTTTGAA CCCCTTCTTT CCCCAATTGT CACACCTGAG AATCTGGAGT TACCTCCATA
CAGAGAGCTT ATCGAATGGT GTGGCAAACA TGGGTATTTT GTAGGAATTA ACTGTAGAGA TCAAGGAGAC ACAGTAGTGG
CTACTCTTGA TGTACAGCTC AAAGAGGTGC TTCTTGTGAG GCAAGGTTTT AGCAAGAAAA GAAAAGATGC GAAAGCGCAT
GCATCTTCCT TACTGCTCAA AGATCTCGAG GTGTCCTATT TTTGTGCTCC ACTATTTTGG TAGTGTATGT TGCAATGTTC
TTTTAGGGGA TAATATAAGC TGACAGGTTT ATTCGTTTTT GCAGGAAAAA GGACTAATAA TCCCAAAGAA TGCAAGCAAG
ACAGAACAAT TTGAAAAGCA TTGTGGCAGC ACTAATCCCT TCAACAATTT GCATGTCGAT GCAATGGATA CACAGACTCC
AAAACCAACC AAGGAAAAAA ACGCAGCTGA TTCAAGGAAC ATTTCTGATC CCCTGCTTGG TAAACCATGT ATGTTCTCAA
TCACCAGTGG TTCTGTTTTT GTTGTTATCT CTGTGCTTTC ATTCATATCA GGACCTCATA TATCCACGTC TGTAGAACGA
ATCAATTTGA TAAAGTTCAA CAATTTTATC TTGTTTCAGT GCACGTGATT GTGAAAACGA GTAAAGGAGG ACCACGCATT
GCATTATATG AGTTGTGTAA AAAGTTGCAA TGGCCAATGC CTACAATGGA ATCTGAGAAA GTACAACCAA GGTACTAAGA
TTTCATACTA GCCTGTGAAT GCCTGTTTAT TTACTTATCT ATGCAACAGT GCAAAATAAC TTACTAATCT TTCATGGTTC
AGCTTTAGCA GCGTGTGCTC CTCCCCTGGT GGTTCCTCTC AGAAAGCTAC CCCCCAAGCG TTCGCTTTCG CTTCAACCAT
TACATTGCAT ATACCAAATG CTGATGTGAT CAGCCTCACA GGAGATGGCC GTGCAGATAA GAAGAGCTCA CAGGATTCTG
CTGCCCTGTT CTTGCTCTAT GAGCTTCAGC GGCGAGGTAC TTTGCAACTC CAGGAGGTGT GAAGGAACGA CAACTGATTG
CTTGCCAACC AGTTGCTTGG AAGTTGGAAT AATAGACCAA CCAGTTGCTT GCCACCACTC AGCTTTGTAC ATCTTCTCCA
GTGTTCACCT TCTGAATTAT GATAAGAGGG TACCCAAAGA ATGGAGAACA GCTGACCTGG TTCTGGTGTG TGTCAGTTGT
TATGTGTGTT TGTCCATATG TTATCTGCGT AGAAACTGAA TAAGCCCCCA AAGTTGTTGC TGACGATAAA CACGCAAATA
TCATGCCCCT GTAGCCTGTA GGTGTTAAAC CAATTGTTCA AGGATAAAAA GAGAGACCAT TTTCAAATCA TGTTTCCTTG
TTCTATTATT ACATAAACAT ACCGGACTTT TTTTCTTATA AAAACTACTC CAGTAAACAT TTGATC

Locus: Os01g0909200

Loading...

Locus: Os01g0909200

Loading...