Os01t0911700-01

Locus

Os01g0911700

Description

Similar to Regulatory protein viviparous-1.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

VP1

CGSNL Gene Name

VIVIPAROUS 1

Oryzabase Gene Symbol Synonym(s)

Vp1* (OSVP1), OsVP1, OsVp1, Vp1, ABI3, OsABI3, OsLFL4, OsVp-1, OSVP1

Oryzabase Gene Name Synonym(s)

Viviparous-1, Protein viviparous homolog, B3 domain-containing protein VP1, Transcription activator VP1-rice, LEAFY COTYLEDON 2 and FUSCA 3-LIKE 4

Transcript Evidence

AK073805 (DDBJ, Best hit)

Protein Evidence

P37398-2 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Functional domain (InterPro)

Transcriptional factor B3 (IPR003340)

DNA-binding pseudobarrel domain (IPR015300)

Full-length cDNA

J033069I02 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0911700-01)

RiceXPro (AK073805)

Others

Oryzabase (2104)

KEGG (Os01t0911700-01)

Transcript

2503 bp

>Os01t0911700-01 Similar to Regulatory protein viviparous-1.
CTCAGTAACTGCACCCACCTCCACACCTACACGCACACAGACAAACAAAGCCAAACCCCC
CGCCTCGCCTACATCTCGCGCTCTCCGCCCCCCGCCCGCCTCCACTCTGCATGGACGCCT
CCGCCGGCTCGTCGGCCCCGGCGGCGGAGATCAGGGGTGAGGCGGCGAGGGATGACGTCT
TTTTCGCTGACGATACCTTCCCGTTGCTCCCGGACTTCCCGTGCCTTTCTTCCCCGTCAA
GCTCAACCTTCTCGTCGTCGTCGTCGTCGAACTCGTCCAGCGCTTTCACCACCGCGGCGG
GAGGGGGTTGCGGCGGTGAGCCGTCCGAGCCGGCCTCGGCGGCGGACGGGTTTGGTGAGC
TCGCCGACATAGACCAGCTCCTCGACCTCGCGTCGCTGTCCGTCCCGTGGGAGGCCGAGC
AGCCGCTGTTCCCGGACGACGTTGGCATGATGATAGAGGACGCCATGTCCGGGCAACCGC
ATCAGGCGGACGACTGTACCGGCGACGGCGATACGAAGGCGGTGATGGAGGCGGCCGGGG
GAGGAGACGACGCCGGCGACGCATGCATGGAGGGGAGTGATGCGCCCGACGATCTGCCGG
CGTTCTTCATGGAGTGGCTCACGAGCAACCGTGAGTACATCTCCGCCGACGACCTCCGCA
GCATCCGCCTCCGCCGATCCACCATCGAGGCGGCGGCCGCGCGGCTCGGCGGCGGGCGCC
AGGGCACCATGCAGCTGCTCAAGCTCATCCTCACCTGGGTGCAGAACCACCACCTCCAGA
AGAAGCGCCCCCGCACGGCGATTGACGACGGCGCCGCGTCGTCGGACCCTCAGCTCCCCA
GCCCCGGCGCAAACCCCGGCTACGAGTTCCCCTCCGGTGGCCAGGAGATGGGCTCCGCCG
CCGCCACATCCTGGATGCCCTACCAGGCCTTCACGCCGCCAGCCGCGTACGGCGGCGACG
CCATGTACCCAGGCGCCGCCGGCCCGTTCCCTTTCCAGCAGAGCTGCAGCAAGAGCAGCG
TGGTCGTGAGCAGCCAGCCGTTCTCCCCGCCGACCGCGGCGGCGGCGGGCGACATGCATG
CGTCGGGCGGAGGGAACATGGCCTGGCCGCAGCAATTCGCGCCGTTCCCCGTCTCCTCCA
CGAGCTCCTACACCATGCCGTCGGTCGTGCCACCGCCGTTCACCGCCGGATTCCCCGGGC
AGTACTCCGGCGGCCACGCCATGTGCTCTCCACGCCTCGCCGGAGTCGAGCCGTCCTCGA
CAAAGGAGGCCCGGAAGAAGCGGATGGCGAGGCAGCGCCGCCTCTCCTGCCTGCAGCAGC
AACGTAGCCAGCAGCTCAACCTGAGCCAGATCCACATCTCCGGCCATCCACAGGAGCCCT
CCCCTCGCGCCGCGCACTCGGCGCCGGTCACCCCGTCGTCGGCCGGCTGCCGGAGCTGGG
GCATCTGGCCGCCGGCGGCCCAGATCATCCAGAATCCCCTATCAAACAAGCCCAATCCTC
CTCCCGCCACGTCGAAGCAGCCGAAACCCTCGCCGGAGAAACCGAAGCCGAAGCCGCAGG
CGGCGGCGACGGCCGGAGCGGAGAGCCTTCAGCGCTCGACGGCTTCAGAGAAGCGGCAGG
CGAAGACGGACAAGAACCTGCGGTTCCTGCTGCAGAAGGTGCTGAAGCAGAGCGACGTCG
GGAGCCTCGGCCGCATCGTGCTCCCCAAAGAAGCAGAGGTTCACCTGCCGGAGCTGAAGA
CGAGGGATGGTGTCTCCATCCCCATGGAAGACATCGGGACGTCTCAGGTGTGGAACATGC
GGTACCGGTTTTGGCCCAACAACAAAAGCAGGATGTATCTTCTCGAAAACACAGGTGATT
TTGTTCGTTCAAACGAGCTGCAGGAGGGTGATTTCATTGTGATCTACTCCGATATCAAGT
CAGGCAAATATCTGATACGTGGTGTGAAGGTGAGGCGCGCGGCGCAGGAGCAAGGCAACT
CGTCGGGGGCGGTAGGTAAGCATAAGCATGGCTCGCCGGAGAAACCCGGCGTCTCGTCCA
ATACAAAGGCCGCCGGCGCCGAGGACGGCACCGGCGGCGATGACAGTGCCGAAGCCGCAG
CGGCGGCGGCGGCAGGCAAGGCTGACGGCGGCGGCTGCAAGGGCAAGTCCCCGCACGGCG
TGCGGCGTTCTCGCCAGGAGGCCGCCGCCGCCGCCTCCATGAGCCAGATGGCGGTTAGCA
TCTGAAGAAACAGATGACAGCAGCAGCAGCAAGCTTCAGTCCATTTGAAGGTTAATTATT
AGCTAGCTAGCTCCGTATTATAACCGATGGTAAAACCTCCTAAAAAAATTAATTAAGTTG
TGCATGTGAATCGTAGCGCTAGCTAGGGATGATATTTGATCAGTAACCCGTAGTCCCCGT
ACCAGTGACGCTTAAGTACGCATGGTTTGGTTGTTCATCGTTGAACCCCTGTAGTGTGTC
GTCGTCCTGTACATGCATCGAATTATGGAATTAATTAATTACC

CDS

2115 bp

>Os01t0911700-01 Similar to Regulatory protein viviparous-1.
ATGGACGCCTCCGCCGGCTCGTCGGCCCCGGCGGCGGAGATCAGGGGTGAGGCGGCGAGG
GATGACGTCTTTTTCGCTGACGATACCTTCCCGTTGCTCCCGGACTTCCCGTGCCTTTCT
TCCCCGTCAAGCTCAACCTTCTCGTCGTCGTCGTCGTCGAACTCGTCCAGCGCTTTCACC
ACCGCGGCGGGAGGGGGTTGCGGCGGTGAGCCGTCCGAGCCGGCCTCGGCGGCGGACGGG
TTTGGTGAGCTCGCCGACATAGACCAGCTCCTCGACCTCGCGTCGCTGTCCGTCCCGTGG
GAGGCCGAGCAGCCGCTGTTCCCGGACGACGTTGGCATGATGATAGAGGACGCCATGTCC
GGGCAACCGCATCAGGCGGACGACTGTACCGGCGACGGCGATACGAAGGCGGTGATGGAG
GCGGCCGGGGGAGGAGACGACGCCGGCGACGCATGCATGGAGGGGAGTGATGCGCCCGAC
GATCTGCCGGCGTTCTTCATGGAGTGGCTCACGAGCAACCGTGAGTACATCTCCGCCGAC
GACCTCCGCAGCATCCGCCTCCGCCGATCCACCATCGAGGCGGCGGCCGCGCGGCTCGGC
GGCGGGCGCCAGGGCACCATGCAGCTGCTCAAGCTCATCCTCACCTGGGTGCAGAACCAC
CACCTCCAGAAGAAGCGCCCCCGCACGGCGATTGACGACGGCGCCGCGTCGTCGGACCCT
CAGCTCCCCAGCCCCGGCGCAAACCCCGGCTACGAGTTCCCCTCCGGTGGCCAGGAGATG
GGCTCCGCCGCCGCCACATCCTGGATGCCCTACCAGGCCTTCACGCCGCCAGCCGCGTAC
GGCGGCGACGCCATGTACCCAGGCGCCGCCGGCCCGTTCCCTTTCCAGCAGAGCTGCAGC
AAGAGCAGCGTGGTCGTGAGCAGCCAGCCGTTCTCCCCGCCGACCGCGGCGGCGGCGGGC
GACATGCATGCGTCGGGCGGAGGGAACATGGCCTGGCCGCAGCAATTCGCGCCGTTCCCC
GTCTCCTCCACGAGCTCCTACACCATGCCGTCGGTCGTGCCACCGCCGTTCACCGCCGGA
TTCCCCGGGCAGTACTCCGGCGGCCACGCCATGTGCTCTCCACGCCTCGCCGGAGTCGAG
CCGTCCTCGACAAAGGAGGCCCGGAAGAAGCGGATGGCGAGGCAGCGCCGCCTCTCCTGC
CTGCAGCAGCAACGTAGCCAGCAGCTCAACCTGAGCCAGATCCACATCTCCGGCCATCCA
CAGGAGCCCTCCCCTCGCGCCGCGCACTCGGCGCCGGTCACCCCGTCGTCGGCCGGCTGC
CGGAGCTGGGGCATCTGGCCGCCGGCGGCCCAGATCATCCAGAATCCCCTATCAAACAAG
CCCAATCCTCCTCCCGCCACGTCGAAGCAGCCGAAACCCTCGCCGGAGAAACCGAAGCCG
AAGCCGCAGGCGGCGGCGACGGCCGGAGCGGAGAGCCTTCAGCGCTCGACGGCTTCAGAG
AAGCGGCAGGCGAAGACGGACAAGAACCTGCGGTTCCTGCTGCAGAAGGTGCTGAAGCAG
AGCGACGTCGGGAGCCTCGGCCGCATCGTGCTCCCCAAAGAAGCAGAGGTTCACCTGCCG
GAGCTGAAGACGAGGGATGGTGTCTCCATCCCCATGGAAGACATCGGGACGTCTCAGGTG
TGGAACATGCGGTACCGGTTTTGGCCCAACAACAAAAGCAGGATGTATCTTCTCGAAAAC
ACAGGTGATTTTGTTCGTTCAAACGAGCTGCAGGAGGGTGATTTCATTGTGATCTACTCC
GATATCAAGTCAGGCAAATATCTGATACGTGGTGTGAAGGTGAGGCGCGCGGCGCAGGAG
CAAGGCAACTCGTCGGGGGCGGTAGGTAAGCATAAGCATGGCTCGCCGGAGAAACCCGGC
GTCTCGTCCAATACAAAGGCCGCCGGCGCCGAGGACGGCACCGGCGGCGATGACAGTGCC
GAAGCCGCAGCGGCGGCGGCGGCAGGCAAGGCTGACGGCGGCGGCTGCAAGGGCAAGTCC
CCGCACGGCGTGCGGCGTTCTCGCCAGGAGGCCGCCGCCGCCGCCTCCATGAGCCAGATG
GCGGTTAGCATCTGA

Protein

705 aa

>Os01t0911700-01 Similar to Regulatory protein viviparous-1.
MDASAGSSAPAAEIRGEAARDDVFFADDTFPLLPDFPCLSSPSSSTFSSSSSSNSSSAFT
TAAGGGCGGEPSEPASAADGFGELADIDQLLDLASLSVPWEAEQPLFPDDVGMMIEDAMS
GQPHQADDCTGDGDTKAVMEAAGGGDDAGDACMEGSDAPDDLPAFFMEWLTSNREYISAD
DLRSIRLRRSTIEAAAARLGGGRQGTMQLLKLILTWVQNHHLQKKRPRTAIDDGAASSDP
QLPSPGANPGYEFPSGGQEMGSAAATSWMPYQAFTPPAAYGGDAMYPGAAGPFPFQQSCS
KSSVVVSSQPFSPPTAAAAGDMHASGGGNMAWPQQFAPFPVSSTSSYTMPSVVPPPFTAG
FPGQYSGGHAMCSPRLAGVEPSSTKEARKKRMARQRRLSCLQQQRSQQLNLSQIHISGHP
QEPSPRAAHSAPVTPSSAGCRSWGIWPPAAQIIQNPLSNKPNPPPATSKQPKPSPEKPKP
KPQAAATAGAESLQRSTASEKRQAKTDKNLRFLLQKVLKQSDVGSLGRIVLPKEAEVHLP
ELKTRDGVSIPMEDIGTSQVWNMRYRFWPNNKSRMYLLENTGDFVRSNELQEGDFIVIYS
DIKSGKYLIRGVKVRRAAQEQGNSSGAVGKHKHGSPEKPGVSSNTKAAGAEDGTGGDDSA
EAAAAAAAGKADGGGCKGKSPHGVRRSRQEAAAAASMSQMAVSI*

5'UTR

chr01:39726875..39726984 (- strand) : 110 bp

CDS

chr01:39726849..39726874 (- strand) : 26 bp

chr01:39725297..39726779 (- strand) : 1483 bp

chr01:39725012..39725101 (- strand) : 90 bp

chr01:39724694..39724791 (- strand) : 98 bp

chr01:39724193..39724239 (- strand) : 47 bp

chr01:39723997..39724073 (- strand) : 77 bp

chr01:39723464..39723757 (- strand) : 294 bp

3'UTR

chr01:39723186..39723463 (- strand) : 278 bp

FASTA

>Os01t0911700-01 class=Sequence position=chr01:39723186..39726984 (- strand)
CTCAGTAACT GCACCCACCT CCACACCTAC ACGCACACAG ACAAACAAAG CCAAACCCCC CGCCTCGCCT ACATCTCGCG
CTCTCCGCCC CCCGCCCGCC TCCACTCTGC ATGGACGCCT CCGCCGGCTC GTCGGCGCCG CACTCGCACG GGAACCCGGG
GAAGCAGGGT GGCGGCGGCG GCGGCGGCGG CGGACGGGGG AAGGCCCCGG CGGCGGAGAT CAGGGGTGAG GCGGCGAGGG
ATGACGTCTT TTTCGCTGAC GATACCTTCC CGTTGCTCCC GGACTTCCCG TGCCTTTCTT CCCCGTCAAG CTCAACCTTC
TCGTCGTCGT CGTCGTCGAA CTCGTCCAGC GCTTTCACCA CCGCGGCGGG AGGGGGTTGC GGCGGTGAGC CGTCCGAGCC
GGCCTCGGCG GCGGACGGGT TTGGTGAGCT CGCCGACATA GACCAGCTCC TCGACCTCGC GTCGCTGTCC GTCCCGTGGG
AGGCCGAGCA GCCGCTGTTC CCGGACGACG TTGGCATGAT GATAGAGGAC GCCATGTCCG GGCAACCGCA TCAGGCGGAC
GACTGTACCG GCGACGGCGA TACGAAGGCG GTGATGGAGG CGGCCGGGGG AGGAGACGAC GCCGGCGACG CATGCATGGA
GGGGAGTGAT GCGCCCGACG ATCTGCCGGC GTTCTTCATG GAGTGGCTCA CGAGCAACCG TGAGTACATC TCCGCCGACG
ACCTCCGCAG CATCCGCCTC CGCCGATCCA CCATCGAGGC GGCGGCCGCG CGGCTCGGCG GCGGGCGCCA GGGCACCATG
CAGCTGCTCA AGCTCATCCT CACCTGGGTG CAGAACCACC ACCTCCAGAA GAAGCGCCCC CGCACGGCGA TTGACGACGG
CGCCGCGTCG TCGGACCCTC AGCTCCCCAG CCCCGGCGCA AACCCCGGCT ACGAGTTCCC CTCCGGTGGC CAGGAGATGG
GCTCCGCCGC CGCCACATCC TGGATGCCCT ACCAGGCCTT CACGCCGCCA GCCGCGTACG GCGGCGACGC CATGTACCCA
GGCGCCGCCG GCCCGTTCCC TTTCCAGCAG AGCTGCAGCA AGAGCAGCGT GGTCGTGAGC AGCCAGCCGT TCTCCCCGCC
GACCGCGGCG GCGGCGGGCG ACATGCATGC GTCGGGCGGA GGGAACATGG CCTGGCCGCA GCAATTCGCG CCGTTCCCCG
TCTCCTCCAC GAGCTCCTAC ACCATGCCGT CGGTCGTGCC ACCGCCGTTC ACCGCCGGAT TCCCCGGGCA GTACTCCGGC
GGCCACGCCA TGTGCTCTCC ACGCCTCGCC GGAGTCGAGC CGTCCTCGAC AAAGGAGGCC CGGAAGAAGC GGATGGCGAG
GCAGCGCCGC CTCTCCTGCC TGCAGCAGCA ACGTAGCCAG CAGCTCAACC TGAGCCAGAT CCACATCTCC GGCCATCCAC
AGGAGCCCTC CCCTCGCGCC GCGCACTCGG CGCCGGTCAC CCCGTCGTCG GCCGGCTGCC GGAGCTGGGG CATCTGGCCG
CCGGCGGCCC AGATCATCCA GAATCCCCTA TCAAACAAGC CCAATCCTCC TCCCGCCACG TCGAAGCAGC CGAAACCCTC
GCCGGAGAAA CCGAAGCCGA AGCCGCAGGC GGCGGCGACG GCCGGAGCGG AGAGCCTTCA GCGCTCGACG GCTTCAGAGA
AGCGGCAGGT GTGCATGCAT GCAGACGATT GACATCAATC GCTATCCACC ATAGCTAGGA TCTCACGCGA GTGAGAACTC
GATTCTCCTC CTCACACACA CTCCACACAC TCAAAACTCA CTCACTCACA TCGCTGTCCA GGGATAGAAT CTCCAATATT
TATCAACCTA GCTAATTAAA CGGCATCGAT TGGATTGCTG CAGGCGAAGA CGGACAAGAA CCTGCGGTTC CTGCTGCAGA
AGGTGCTGAA GCAGAGCGAC GTCGGGAGCC TCGGCCGCAT CGTGCTCCCC AAAGTGAGAC AGTCACCACC ATCTCGAACA
CCTTCTCCTT CCAAATCCAC TACCCCACTT GGCACAAATC CATTCCATGG AAGGATCCCA CTTGCACACA CTCACATACT
TGATGTTTCT CCCCTAATCA AAGACGGAAT TTGCCTGAAC CTTCTCTTCA CATTTCCGAT CATGGTAGAA CTAAAAAGTC
TCCCCTTTCT TGATCTGTGG ATGGTTTCAG AAGGAAGCAG AGGTTCACCT GCCGGAGCTG AAGACGAGGG ATGGTGTCTC
CATCCCCATG GAAGACATCG GGACGTCTCA GGTGTGGAAC ATGCGGTACC GGTGAGTAAT CAACATTCGA TCGAAGCATC
AAGCATGATT TGGGATTGCT TATTAAGCTT GTTTAAGTCC ACTTGCTTCT TTGTTAATTG GGAGGGGATA GAAACCTCTG
AACCAGAAAT AGTAAATGAC TATGGGATGG TCCCTTTCCC AATTGGGCAA GTGGGTCATA CGAACATATC ATTGGAATCT
GGGAGTCAAA TAGGAGCATG CATTCATCGT GTTCTATGTT GATGCTCAAG TGCATACAAC AAAAAAATAA AAGTGATCTT
TTCCTGCTGT TTTCAGTACT AACATTATGC ATATGATTTT TGCTGGTTCT GCTGAGCTCA TGTTTTTGAT TAATTAATTT
AATTATTTCC ATTGGCAATA TTATATATGC ACAAGTTATT CGAATACATG ATGGCTTAGA TTTTGATTCA CTGACATTAA
TGGATATTGA TTTTCATGAA CACAGGTTTT GGCCCAACAA CAAAAGCAGG ATGTATCTTC TCGAAAACAC AGGTGAATAG
CAAACTTTTG AATTATTCAA ATTTTACAGT CACAAGCCAT GCCAATAACT TCCATCCTTA ATTTGTGGCT CTCAAGTATT
GTTGATTAAT CGTTGTCATA TGTTTTTTCA GGTGATTTTG TTCGTTCAAA CGAGCTGCAG GAGGGTGATT TCATTGTGAT
CTACTCCGAT ATCAAGTCAG GCAAATATGT AATGTTCATC CATCATTGCC CTTCCCACTT CTTTCGAGTA CTCTTTAACT
CAACTCAGTT GGATGTGATT TTGAGTGCCA ATAAGCTATA TATAGTTGCT GCATGCCACT GTTTGTCTTT AATTCGGATG
ACCAGTTTGG CAGTATCTTT GTTTATGGAG TACTTCTGTT AATTTCTGCA AGCAGCAGCT AATTAATTAT TAACCGTAAT
CTTAATTTAT CTCTTAATTA TTAGCAGCTG ATACGTGGTG TGAAGGTGAG GCGCGCGGCG CAGGAGCAAG GCAACTCGTC
GGGGGCGGTA GGTAAGCATA AGCATGGCTC GCCGGAGAAA CCCGGCGTCT CGTCCAATAC AAAGGCCGCC GGCGCCGAGG
ACGGCACCGG CGGCGATGAC AGTGCCGAAG CCGCAGCGGC GGCGGCGGCA GGCAAGGCTG ACGGCGGCGG CTGCAAGGGC
AAGTCCCCGC ACGGCGTGCG GCGTTCTCGC CAGGAGGCCG CCGCCGCCGC CTCCATGAGC CAGATGGCGG TTAGCATCTG
AAGAAACAGA TGACAGCAGC AGCAGCAAGC TTCAGTCCAT TTGAAGGTTA ATTATTAGCT AGCTAGCTCC GTATTATAAC
CGATGGTAAA ACCTCCTAAA AAAATTAATT AAGTTGTGCA TGTGAATCGT AGCGCTAGCT AGGGATGATA TTTGATCAGT
AACCCGTAGT CCCCGTACCA GTGACGCTTA AGTACGCATG GTTTGGTTGT TCATCGTTGA ACCCCTGTAG TGTGTCGTCG
TCCTGTACAT GCATCGAATT ATGGAATTAA TTAATTACC