Os01t0911700-02

Locus

Os01g0911700

Description

Transcription activator VP1-rice.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

VP1

CGSNL Gene Name

VIVIPAROUS 1

Oryzabase Gene Symbol Synonym(s)

Vp1* (OSVP1), OsVP1, OsVp1, Vp1, ABI3, OsABI3, OsLFL4, OsVp-1, OSVP1

Oryzabase Gene Name Synonym(s)

Viviparous-1, Protein viviparous homolog, B3 domain-containing protein VP1, Transcription activator VP1-rice, LEAFY COTYLEDON 2 and FUSCA 3-LIKE 4

Transcript Evidence

AK105441 (DDBJ, Best hit)

Protein Evidence

P37398 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Functional domain (InterPro)

Transcriptional factor B3 (IPR003340)

DNA-binding pseudobarrel domain (IPR015300)

Full-length cDNA

001-125-A06 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0911700-02)

RiceXPro (AK105441)

Others

Oryzabase (2104)

KEGG (Os01t0911700-02)

Transcript

2477 bp

>Os01t0911700-02 Transcription activator VP1-rice.
ATGGACGCCTCCGCCGGCTCGTCGGCGCCGCACTCGCACGGGAACCCGGGGAAGCAGGGT
GGCGGCGGCGGCGGCGGCGGCGGACGGGGGAAGGCCCCGGCGGCGGAGATCAGGGGTGAG
GCGGCGAGGGATGACGTCTTTTTCGCTGACGATACCTTCCCGTTGCTCCCGGACTTCCCG
TGCCTTTCTTCCCCGTCAAGCTCAACCTTCTCGTCGTCGTCGTCGTCGAACTCGTCCAGC
GCTTTCACCACCGCGGCGGGAGGGGGTTGCGGCGGTGAGCCGTCCGAGCCGGCCTCGGCG
GCGGACGGGTTTGGTGAGCTCGCCGACATAGACCAGCTCCTCGACCTCGCGTCGCTGTCC
GTCCCGTGGGAGGCCGAGCAGCCGCTGTTCCCGGACGACGTTGGCATGATGATAGAGGAC
GCCATGTCCGGGCAACCGCATCAGGCGGACGACTGTACCGGCGACGGCGATACGAAGGCG
GTGATGGAGGCGGCCGGGGGAGGAGACGACGCCGGCGACGCATGCATGGAGGGGAGTGAT
GCGCCCGACGATCTGCCGGCGTTCTTCATGGAGTGGCTCACGAGCAACCGTGAGTACATC
TCCGCCGACGACCTCCGCAGCATCCGCCTCCGCCGATCCACCATCGAGGCGGCGGCCGCG
CGGCTCGGCGGCGGGCGCCAGGGCACCATGCAGCTGCTCAAGCTCATCCTCACCTGGGTG
CAGAACCACCACCTCCAGAAGAAGCGCCCCCGCACGGCGATTGACGACGGCGCCGCGTCG
TCGGACCCTCAGCTCCCCAGCCCCGGCGCAAACCCCGGCTACGAGTTCCCCTCCGGTGGC
CAGGAGATGGGCTCCGCCGCCGCCACATCCTGGATGCCCTACCAGGCCTTCACGCCGCCA
GCCGCGTACGGCGGCGACGCCATGTACCCAGGCGCCGCCGGCCCGTTCCCTTTCCAGCAG
AGCTGCAGCAAGAGCAGCGTGGTCGTGAGCAGCCAGCCGTTCTCCCCGCCGACCGCGGCG
GCGGCGGGCGACATGCATGCGTCGGGCGGAGGGAACATGGCCTGGCCGCAGCAATTCGCG
CCGTTCCCCGTCTCCTCCACGAGCTCCTACACCATGCCGTCGGTCGTGCCACCGCCGTTC
ACCGCCGGATTCCCCGGGCAGTACTCCGGCGGCCACGCCATGTGCTCTCCACGCCTCGCC
GGAGTCGAGCCGTCCTCGACAAAGGAGGCCCGGAAGAAGCGGATGGCGAGGCAGCGCCGC
CTCTCCTGCCTGCAGCAGCAACGTAGCCAGCAGCTCAACCTGAGCCAGATCCACATCTCC
GGCCATCCACAGGAGCCCTCCCCTCGCGCCGCGCACTCGGCGCCGGTCACCCCGTCGTCG
GCCGGCTGCCGGAGCTGGGGCATCTGGCCGCCGGCGGCCCAGATCATCCAGAATCCCCTA
TCAAACAAGCCCAATCCTCCTCCCGCCACGTCGAAGCAGCCGAAACCCTCGCCGGAGAAA
CCGAAGCCGAAGCCGCAGGCGGCGGCGACGGCCGGAGCGGAGAGCCTTCAGCGCTCGACG
GCTTCAGAGAAGCGGCAGGCGAAGACGGACAAGAACCTGCGGTTCCTGCTGCAGAAGGTG
CTGAAGCAGAGCGACGTCGGGAGCCTCGGCCGCATCGTGCTCCCCAAAGAAGCAGAGGTT
CACCTGCCGGAGCTGAAGACGAGGGATGGTGTCTCCATCCCCATGGAAGACATCGGGACG
TCTCAGGTGTGGAACATGCGGTACCGGTTTTGGCCCAACAACAAAAGCAGGATGTATCTT
CTCGAAAACACAGGTGATTTTGTTCGTTCAAACGAGCTGCAGGAGGGTGATTTCATTGTG
ATCTACTCCGATATCAAGTCAGGCAAATATCTGATACGTGGTGTGAAGGTGAGGCGCGCG
GCGCAGGAGCAAGGCAACTCGTCGGGGGCGGTAGGTAAGCATAAGCATGGCTCGCCGGAG
AAACCCGGCGTCTCGTCCAATACAAAGGCCGCCGGCGCCGAGGACGGCACCGGCGGCGAT
GACAGTGCCGAAGCCGCAGCGGCGGCGGCGGCAGGCAAGGCTGACGGCGGCGGCTGCAAG
GGCAAGTCCCCGCACGGCGTGCGGCGTTCTCGCCAGGAGGCCGCCGCCGCCGCCTCCATG
AGCCAGATGGCGGTTAGCATCTGAAGAAACAGATGACAGCAGCAGCAGCAAGCTTCAGTC
CATTTGAAGGTTAATTATTAGCTAGCTAGCTCCGTATTATAACCGATGGTAAAACCTCCT
AAAAAAATTAATTAAGTTGTGCATGTGAATCGTAGCGCTAGCTAGGGATGATATTTGATC
AGTAACCCGTAGTCCCCGTACCAGTGACGCTTAAGTACGCATGGTTTGGTTGTTCATCGT
TGAACCCCTGTAGTGTGTCGTCGTCCTGTACATGCATCGAATTATGGAATTAATTAATTA
CCTTAATCGTCGTGTCC

CDS

2184 bp

>Os01t0911700-02 Transcription activator VP1-rice.
ATGGACGCCTCCGCCGGCTCGTCGGCGCCGCACTCGCACGGGAACCCGGGGAAGCAGGGT
GGCGGCGGCGGCGGCGGCGGCGGACGGGGGAAGGCCCCGGCGGCGGAGATCAGGGGTGAG
GCGGCGAGGGATGACGTCTTTTTCGCTGACGATACCTTCCCGTTGCTCCCGGACTTCCCG
TGCCTTTCTTCCCCGTCAAGCTCAACCTTCTCGTCGTCGTCGTCGTCGAACTCGTCCAGC
GCTTTCACCACCGCGGCGGGAGGGGGTTGCGGCGGTGAGCCGTCCGAGCCGGCCTCGGCG
GCGGACGGGTTTGGTGAGCTCGCCGACATAGACCAGCTCCTCGACCTCGCGTCGCTGTCC
GTCCCGTGGGAGGCCGAGCAGCCGCTGTTCCCGGACGACGTTGGCATGATGATAGAGGAC
GCCATGTCCGGGCAACCGCATCAGGCGGACGACTGTACCGGCGACGGCGATACGAAGGCG
GTGATGGAGGCGGCCGGGGGAGGAGACGACGCCGGCGACGCATGCATGGAGGGGAGTGAT
GCGCCCGACGATCTGCCGGCGTTCTTCATGGAGTGGCTCACGAGCAACCGTGAGTACATC
TCCGCCGACGACCTCCGCAGCATCCGCCTCCGCCGATCCACCATCGAGGCGGCGGCCGCG
CGGCTCGGCGGCGGGCGCCAGGGCACCATGCAGCTGCTCAAGCTCATCCTCACCTGGGTG
CAGAACCACCACCTCCAGAAGAAGCGCCCCCGCACGGCGATTGACGACGGCGCCGCGTCG
TCGGACCCTCAGCTCCCCAGCCCCGGCGCAAACCCCGGCTACGAGTTCCCCTCCGGTGGC
CAGGAGATGGGCTCCGCCGCCGCCACATCCTGGATGCCCTACCAGGCCTTCACGCCGCCA
GCCGCGTACGGCGGCGACGCCATGTACCCAGGCGCCGCCGGCCCGTTCCCTTTCCAGCAG
AGCTGCAGCAAGAGCAGCGTGGTCGTGAGCAGCCAGCCGTTCTCCCCGCCGACCGCGGCG
GCGGCGGGCGACATGCATGCGTCGGGCGGAGGGAACATGGCCTGGCCGCAGCAATTCGCG
CCGTTCCCCGTCTCCTCCACGAGCTCCTACACCATGCCGTCGGTCGTGCCACCGCCGTTC
ACCGCCGGATTCCCCGGGCAGTACTCCGGCGGCCACGCCATGTGCTCTCCACGCCTCGCC
GGAGTCGAGCCGTCCTCGACAAAGGAGGCCCGGAAGAAGCGGATGGCGAGGCAGCGCCGC
CTCTCCTGCCTGCAGCAGCAACGTAGCCAGCAGCTCAACCTGAGCCAGATCCACATCTCC
GGCCATCCACAGGAGCCCTCCCCTCGCGCCGCGCACTCGGCGCCGGTCACCCCGTCGTCG
GCCGGCTGCCGGAGCTGGGGCATCTGGCCGCCGGCGGCCCAGATCATCCAGAATCCCCTA
TCAAACAAGCCCAATCCTCCTCCCGCCACGTCGAAGCAGCCGAAACCCTCGCCGGAGAAA
CCGAAGCCGAAGCCGCAGGCGGCGGCGACGGCCGGAGCGGAGAGCCTTCAGCGCTCGACG
GCTTCAGAGAAGCGGCAGGCGAAGACGGACAAGAACCTGCGGTTCCTGCTGCAGAAGGTG
CTGAAGCAGAGCGACGTCGGGAGCCTCGGCCGCATCGTGCTCCCCAAAGAAGCAGAGGTT
CACCTGCCGGAGCTGAAGACGAGGGATGGTGTCTCCATCCCCATGGAAGACATCGGGACG
TCTCAGGTGTGGAACATGCGGTACCGGTTTTGGCCCAACAACAAAAGCAGGATGTATCTT
CTCGAAAACACAGGTGATTTTGTTCGTTCAAACGAGCTGCAGGAGGGTGATTTCATTGTG
ATCTACTCCGATATCAAGTCAGGCAAATATCTGATACGTGGTGTGAAGGTGAGGCGCGCG
GCGCAGGAGCAAGGCAACTCGTCGGGGGCGGTAGGTAAGCATAAGCATGGCTCGCCGGAG
AAACCCGGCGTCTCGTCCAATACAAAGGCCGCCGGCGCCGAGGACGGCACCGGCGGCGAT
GACAGTGCCGAAGCCGCAGCGGCGGCGGCGGCAGGCAAGGCTGACGGCGGCGGCTGCAAG
GGCAAGTCCCCGCACGGCGTGCGGCGTTCTCGCCAGGAGGCCGCCGCCGCCGCCTCCATG
AGCCAGATGGCGGTTAGCATCTGA

Protein

728 aa

>Os01t0911700-02 Transcription activator VP1-rice.
MDASAGSSAPHSHGNPGKQGGGGGGGGGRGKAPAAEIRGEAARDDVFFADDTFPLLPDFP
CLSSPSSSTFSSSSSSNSSSAFTTAAGGGCGGEPSEPASAADGFGELADIDQLLDLASLS
VPWEAEQPLFPDDVGMMIEDAMSGQPHQADDCTGDGDTKAVMEAAGGGDDAGDACMEGSD
APDDLPAFFMEWLTSNREYISADDLRSIRLRRSTIEAAAARLGGGRQGTMQLLKLILTWV
QNHHLQKKRPRTAIDDGAASSDPQLPSPGANPGYEFPSGGQEMGSAAATSWMPYQAFTPP
AAYGGDAMYPGAAGPFPFQQSCSKSSVVVSSQPFSPPTAAAAGDMHASGGGNMAWPQQFA
PFPVSSTSSYTMPSVVPPPFTAGFPGQYSGGHAMCSPRLAGVEPSSTKEARKKRMARQRR
LSCLQQQRSQQLNLSQIHISGHPQEPSPRAAHSAPVTPSSAGCRSWGIWPPAAQIIQNPL
SNKPNPPPATSKQPKPSPEKPKPKPQAAATAGAESLQRSTASEKRQAKTDKNLRFLLQKV
LKQSDVGSLGRIVLPKEAEVHLPELKTRDGVSIPMEDIGTSQVWNMRYRFWPNNKSRMYL
LENTGDFVRSNELQEGDFIVIYSDIKSGKYLIRGVKVRRAAQEQGNSSGAVGKHKHGSPE
KPGVSSNTKAAGAEDGTGGDDSAEAAAAAAAGKADGGGCKGKSPHGVRRSRQEAAAAASM
SQMAVSI*

CDS

chr01:39725297..39726874 (- strand) : 1578 bp

chr01:39725012..39725101 (- strand) : 90 bp

chr01:39724694..39724791 (- strand) : 98 bp

chr01:39724193..39724239 (- strand) : 47 bp

chr01:39723997..39724073 (- strand) : 77 bp

chr01:39723464..39723757 (- strand) : 294 bp

3'UTR

chr01:39723171..39723463 (- strand) : 293 bp

FASTA

>Os01t0911700-02 class=Sequence position=chr01:39723171..39726874 (- strand)
ATGGACGCCT CCGCCGGCTC GTCGGCGCCG CACTCGCACG GGAACCCGGG GAAGCAGGGT GGCGGCGGCG GCGGCGGCGG
CGGACGGGGG AAGGCCCCGG CGGCGGAGAT CAGGGGTGAG GCGGCGAGGG ATGACGTCTT TTTCGCTGAC GATACCTTCC
CGTTGCTCCC GGACTTCCCG TGCCTTTCTT CCCCGTCAAG CTCAACCTTC TCGTCGTCGT CGTCGTCGAA CTCGTCCAGC
GCTTTCACCA CCGCGGCGGG AGGGGGTTGC GGCGGTGAGC CGTCCGAGCC GGCCTCGGCG GCGGACGGGT TTGGTGAGCT
CGCCGACATA GACCAGCTCC TCGACCTCGC GTCGCTGTCC GTCCCGTGGG AGGCCGAGCA GCCGCTGTTC CCGGACGACG
TTGGCATGAT GATAGAGGAC GCCATGTCCG GGCAACCGCA TCAGGCGGAC GACTGTACCG GCGACGGCGA TACGAAGGCG
GTGATGGAGG CGGCCGGGGG AGGAGACGAC GCCGGCGACG CATGCATGGA GGGGAGTGAT GCGCCCGACG ATCTGCCGGC
GTTCTTCATG GAGTGGCTCA CGAGCAACCG TGAGTACATC TCCGCCGACG ACCTCCGCAG CATCCGCCTC CGCCGATCCA
CCATCGAGGC GGCGGCCGCG CGGCTCGGCG GCGGGCGCCA GGGCACCATG CAGCTGCTCA AGCTCATCCT CACCTGGGTG
CAGAACCACC ACCTCCAGAA GAAGCGCCCC CGCACGGCGA TTGACGACGG CGCCGCGTCG TCGGACCCTC AGCTCCCCAG
CCCCGGCGCA AACCCCGGCT ACGAGTTCCC CTCCGGTGGC CAGGAGATGG GCTCCGCCGC CGCCACATCC TGGATGCCCT
ACCAGGCCTT CACGCCGCCA GCCGCGTACG GCGGCGACGC CATGTACCCA GGCGCCGCCG GCCCGTTCCC TTTCCAGCAG
AGCTGCAGCA AGAGCAGCGT GGTCGTGAGC AGCCAGCCGT TCTCCCCGCC GACCGCGGCG GCGGCGGGCG ACATGCATGC
GTCGGGCGGA GGGAACATGG CCTGGCCGCA GCAATTCGCG CCGTTCCCCG TCTCCTCCAC GAGCTCCTAC ACCATGCCGT
CGGTCGTGCC ACCGCCGTTC ACCGCCGGAT TCCCCGGGCA GTACTCCGGC GGCCACGCCA TGTGCTCTCC ACGCCTCGCC
GGAGTCGAGC CGTCCTCGAC AAAGGAGGCC CGGAAGAAGC GGATGGCGAG GCAGCGCCGC CTCTCCTGCC TGCAGCAGCA
ACGTAGCCAG CAGCTCAACC TGAGCCAGAT CCACATCTCC GGCCATCCAC AGGAGCCCTC CCCTCGCGCC GCGCACTCGG
CGCCGGTCAC CCCGTCGTCG GCCGGCTGCC GGAGCTGGGG CATCTGGCCG CCGGCGGCCC AGATCATCCA GAATCCCCTA
TCAAACAAGC CCAATCCTCC TCCCGCCACG TCGAAGCAGC CGAAACCCTC GCCGGAGAAA CCGAAGCCGA AGCCGCAGGC
GGCGGCGACG GCCGGAGCGG AGAGCCTTCA GCGCTCGACG GCTTCAGAGA AGCGGCAGGT GTGCATGCAT GCAGACGATT
GACATCAATC GCTATCCACC ATAGCTAGGA TCTCACGCGA GTGAGAACTC GATTCTCCTC CTCACACACA CTCCACACAC
TCAAAACTCA CTCACTCACA TCGCTGTCCA GGGATAGAAT CTCCAATATT TATCAACCTA GCTAATTAAA CGGCATCGAT
TGGATTGCTG CAGGCGAAGA CGGACAAGAA CCTGCGGTTC CTGCTGCAGA AGGTGCTGAA GCAGAGCGAC GTCGGGAGCC
TCGGCCGCAT CGTGCTCCCC AAAGTGAGAC AGTCACCACC ATCTCGAACA CCTTCTCCTT CCAAATCCAC TACCCCACTT
GGCACAAATC CATTCCATGG AAGGATCCCA CTTGCACACA CTCACATACT TGATGTTTCT CCCCTAATCA AAGACGGAAT
TTGCCTGAAC CTTCTCTTCA CATTTCCGAT CATGGTAGAA CTAAAAAGTC TCCCCTTTCT TGATCTGTGG ATGGTTTCAG
AAGGAAGCAG AGGTTCACCT GCCGGAGCTG AAGACGAGGG ATGGTGTCTC CATCCCCATG GAAGACATCG GGACGTCTCA
GGTGTGGAAC ATGCGGTACC GGTGAGTAAT CAACATTCGA TCGAAGCATC AAGCATGATT TGGGATTGCT TATTAAGCTT
GTTTAAGTCC ACTTGCTTCT TTGTTAATTG GGAGGGGATA GAAACCTCTG AACCAGAAAT AGTAAATGAC TATGGGATGG
TCCCTTTCCC AATTGGGCAA GTGGGTCATA CGAACATATC ATTGGAATCT GGGAGTCAAA TAGGAGCATG CATTCATCGT
GTTCTATGTT GATGCTCAAG TGCATACAAC AAAAAAATAA AAGTGATCTT TTCCTGCTGT TTTCAGTACT AACATTATGC
ATATGATTTT TGCTGGTTCT GCTGAGCTCA TGTTTTTGAT TAATTAATTT AATTATTTCC ATTGGCAATA TTATATATGC
ACAAGTTATT CGAATACATG ATGGCTTAGA TTTTGATTCA CTGACATTAA TGGATATTGA TTTTCATGAA CACAGGTTTT
GGCCCAACAA CAAAAGCAGG ATGTATCTTC TCGAAAACAC AGGTGAATAG CAAACTTTTG AATTATTCAA ATTTTACAGT
CACAAGCCAT GCCAATAACT TCCATCCTTA ATTTGTGGCT CTCAAGTATT GTTGATTAAT CGTTGTCATA TGTTTTTTCA
GGTGATTTTG TTCGTTCAAA CGAGCTGCAG GAGGGTGATT TCATTGTGAT CTACTCCGAT ATCAAGTCAG GCAAATATGT
AATGTTCATC CATCATTGCC CTTCCCACTT CTTTCGAGTA CTCTTTAACT CAACTCAGTT GGATGTGATT TTGAGTGCCA
ATAAGCTATA TATAGTTGCT GCATGCCACT GTTTGTCTTT AATTCGGATG ACCAGTTTGG CAGTATCTTT GTTTATGGAG
TACTTCTGTT AATTTCTGCA AGCAGCAGCT AATTAATTAT TAACCGTAAT CTTAATTTAT CTCTTAATTA TTAGCAGCTG
ATACGTGGTG TGAAGGTGAG GCGCGCGGCG CAGGAGCAAG GCAACTCGTC GGGGGCGGTA GGTAAGCATA AGCATGGCTC
GCCGGAGAAA CCCGGCGTCT CGTCCAATAC AAAGGCCGCC GGCGCCGAGG ACGGCACCGG CGGCGATGAC AGTGCCGAAG
CCGCAGCGGC GGCGGCGGCA GGCAAGGCTG ACGGCGGCGG CTGCAAGGGC AAGTCCCCGC ACGGCGTGCG GCGTTCTCGC
CAGGAGGCCG CCGCCGCCGC CTCCATGAGC CAGATGGCGG TTAGCATCTG AAGAAACAGA TGACAGCAGC AGCAGCAAGC
TTCAGTCCAT TTGAAGGTTA ATTATTAGCT AGCTAGCTCC GTATTATAAC CGATGGTAAA ACCTCCTAAA AAAATTAATT
AAGTTGTGCA TGTGAATCGT AGCGCTAGCT AGGGATGATA TTTGATCAGT AACCCGTAGT CCCCGTACCA GTGACGCTTA
AGTACGCATG GTTTGGTTGT TCATCGTTGA ACCCCTGTAG TGTGTCGTCG TCCTGTACAT GCATCGAATT ATGGAATTAA
TTAATTACCT TAATCGTCGT GTCC