Os01t0914800-01

Locus

Os01g0914800

Description

Protein of unknown function DUF231, plant domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsTBL39, TBL39

Oryzabase Gene Name Synonym(s)

trichome birefringence-like 39

Transcript Evidence

AK102791 (DDBJ, Best hit)

Protein Evidence

XP_002865870.1 (RefSeq)

Literature

Note

Manual Curation

Functional domain (InterPro)

Domain of unknown function DUF231, plant (IPR004253)

Full-length cDNA

J033107P14 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0914800-01)

RiceXPro (AK102791)

Others

Oryzabase (21494)

KEGG (Os01t0914800-01)

Transcript

2100 bp

>Os01t0914800-01 Protein of unknown function DUF231, plant domain containing protein.
CTAGCAGTTCTTCCTTCCGTTCCTTCCCTCTATCTATCCTCCGCCTCGTCCTCGCCACGC
GCGAAGGCGGCGTCGATCGGTTCCCCCATTTTTCTCATCGATCCCTCGTGGCCTCCTCCC
CGCCGCCGCGCCACCTCGTCTCGAAGATTTCTTTGATGCGTGGTGGCAGTGGCGTTTGGA
TCTTGGTGCCGCCATGAGTCCGCCGGGGAGGAAGGCCCCGGCCGGTGCGGGCGGGATCCG
TCGGTGGCTCTCCACCGTCGTCGTGTCGGTGGTGGCTCTTGTGCTAACCCTAGTAGTGAT
ATCGCTATCGGTGGGCTCGTCTCTGACCGGGGCATCGCTACACGAGTACCTCTTTGTCAG
ACCTAGTGATTCATCCAAGCTTACTGATGGGAACATGAATGGTACTGCCGTTGGTGTTCC
ATTACAAGAGGAAGTGTTGCAGGGTGGCAAGGAAGTACCCGTGGAGCACGGTGTTCAGAG
TGGCGGCGTGAATTCGAGCGAGACGGGTGAAATCGATACCAAAGTACAAGATCCAGTTGT
TACCGATGATACCGCGTCAGTGCCTGATGAGAGAAATCTCCCTGTCTCATCGGATTCATC
CGACAATCTTCAGAAGACTAATGAAGGTAGCTGTGATCTATACCATGGACATTGGGTTTT
TGATTCTTCTGGACCACTATACACAAACAACTCTTGCCCGATCATCACGCAGATGCAGAA
TTGTCAAGGAAATGGTCGACCTGATAAGGATTATGAAAATTATAGATGGAAACCAGAACA
GTGCATCCTACCACGCTTTGATGGACCAAAGTTCCTGGAGTTGATGAGAGGCAAGACAAT
TGCATTTGTTGGTGATTCAGTTGCCAGAAATCAGATGGAATCCCTCCTCTGCATTCTGTG
GCAGGTAGAGGCCCCAGTAAACCGTGGTAGCCGCAGGATGAGCAAGTGGATTTTTAGGTC
AACCTCAACAATTATCGTCCGCATCTGGTCGTCTTGGTTAGTGCACAGGTCAACTGAAGC
TGTGGGGTTTGCTCCTAAGGGTATCGATAAGGTTTTCCTGGATATCCCGGATGAGACCTT
TATGGAATTTATCCCACGTTTTGATGTGCTTGTCCTCTCCTCTGGGCACTGGTTTGCCAA
ACGGTCTGCTTATATCCTGAATGGCAATGTTGTTGGAGGGCAGCTCTGGTGGCCTCGTAA
AGCTGGAAATATGCAGATCAACAATGTTGATGCTTTTGGTATATCTGTTGAGACATGCCT
AACTGCTCTAGCTACCAATCCAAATTTCACAGGTATAGCTATCGTGCGCACATATTCACC
AGATCATTATGAAGGTGGGGCTTGGAATACCGGTGGATCATGCACTGGAAAGACTAAGCC
CTTGGATGTGGTGGTGAGGAATGGATTCACGGACACCATGTATGGAAAGCAGGTTTCAGG
GTTCACAAAAGCAGTGCAGAATTCTGGGAAACATGGTTCCAGGTTGAAATTGATGGACAT
CACTGAGCCCTTTGCCCTGAGGCCTGATGGGCATCCTGGTCCATATAGAAGTACTGACCC
AAACAAGAAGACGCAAAGAGGTCCAGATGGAAGGCCTCCACCTCAGGATTGCCTACATTG
GTGCATGCCAGGACCTGTAGATACATGGAATGAGATGTTGCTAGAGACCATACGAAGAGA
GTTCGAGGGAGTGAGAAGCTGAAGAAAAACACTCATTGGCTGCTTGATTTCTATCATGTG
ATACGACCTGCAAAAACTAATTAAGCTTCTAGCATTGGTGTATACCTCATTACATATCGT
GTTGTTGTTCTCCCACAGATAGGAAGGAAATATAGCTTTTGGTTGGACAAAAAAACAAAT
TGTAGGCATGTTGTCAACAGTCGGGATAGAAGTACAGAGGGGTAGACAGTTAGAGAGAGA
GGTTATGATGGATGATACTGTGCAATTGATCTGTATCTAGTTTTTTGTCTGACACATTCT
TGGAGATATGATCCGTTGACGAATTTTGTGGAACTACATATGATCTCATATCTCGAGCAC
CTGTCAATCTATGAGGCAGATGCTGATTTTGGTTTATAACAGATGAAAGAGAACTTGTTC

CDS

1509 bp

>Os01t0914800-01 Protein of unknown function DUF231, plant domain containing protein.
ATGAGTCCGCCGGGGAGGAAGGCCCCGGCCGGTGCGGGCGGGATCCGTCGGTGGCTCTCC
ACCGTCGTCGTGTCGGTGGTGGCTCTTGTGCTAACCCTAGTAGTGATATCGCTATCGGTG
GGCTCGTCTCTGACCGGGGCATCGCTACACGAGTACCTCTTTGTCAGACCTAGTGATTCA
TCCAAGCTTACTGATGGGAACATGAATGGTACTGCCGTTGGTGTTCCATTACAAGAGGAA
GTGTTGCAGGGTGGCAAGGAAGTACCCGTGGAGCACGGTGTTCAGAGTGGCGGCGTGAAT
TCGAGCGAGACGGGTGAAATCGATACCAAAGTACAAGATCCAGTTGTTACCGATGATACC
GCGTCAGTGCCTGATGAGAGAAATCTCCCTGTCTCATCGGATTCATCCGACAATCTTCAG
AAGACTAATGAAGGTAGCTGTGATCTATACCATGGACATTGGGTTTTTGATTCTTCTGGA
CCACTATACACAAACAACTCTTGCCCGATCATCACGCAGATGCAGAATTGTCAAGGAAAT
GGTCGACCTGATAAGGATTATGAAAATTATAGATGGAAACCAGAACAGTGCATCCTACCA
CGCTTTGATGGACCAAAGTTCCTGGAGTTGATGAGAGGCAAGACAATTGCATTTGTTGGT
GATTCAGTTGCCAGAAATCAGATGGAATCCCTCCTCTGCATTCTGTGGCAGGTAGAGGCC
CCAGTAAACCGTGGTAGCCGCAGGATGAGCAAGTGGATTTTTAGGTCAACCTCAACAATT
ATCGTCCGCATCTGGTCGTCTTGGTTAGTGCACAGGTCAACTGAAGCTGTGGGGTTTGCT
CCTAAGGGTATCGATAAGGTTTTCCTGGATATCCCGGATGAGACCTTTATGGAATTTATC
CCACGTTTTGATGTGCTTGTCCTCTCCTCTGGGCACTGGTTTGCCAAACGGTCTGCTTAT
ATCCTGAATGGCAATGTTGTTGGAGGGCAGCTCTGGTGGCCTCGTAAAGCTGGAAATATG
CAGATCAACAATGTTGATGCTTTTGGTATATCTGTTGAGACATGCCTAACTGCTCTAGCT
ACCAATCCAAATTTCACAGGTATAGCTATCGTGCGCACATATTCACCAGATCATTATGAA
GGTGGGGCTTGGAATACCGGTGGATCATGCACTGGAAAGACTAAGCCCTTGGATGTGGTG
GTGAGGAATGGATTCACGGACACCATGTATGGAAAGCAGGTTTCAGGGTTCACAAAAGCA
GTGCAGAATTCTGGGAAACATGGTTCCAGGTTGAAATTGATGGACATCACTGAGCCCTTT
GCCCTGAGGCCTGATGGGCATCCTGGTCCATATAGAAGTACTGACCCAAACAAGAAGACG
CAAAGAGGTCCAGATGGAAGGCCTCCACCTCAGGATTGCCTACATTGGTGCATGCCAGGA
CCTGTAGATACATGGAATGAGATGTTGCTAGAGACCATACGAAGAGAGTTCGAGGGAGTG
AGAAGCTGA

Protein

503 aa

>Os01t0914800-01 Protein of unknown function DUF231, plant domain containing protein.
MSPPGRKAPAGAGGIRRWLSTVVVSVVALVLTLVVISLSVGSSLTGASLHEYLFVRPSDS
SKLTDGNMNGTAVGVPLQEEVLQGGKEVPVEHGVQSGGVNSSETGEIDTKVQDPVVTDDT
ASVPDERNLPVSSDSSDNLQKTNEGSCDLYHGHWVFDSSGPLYTNNSCPIITQMQNCQGN
GRPDKDYENYRWKPEQCILPRFDGPKFLELMRGKTIAFVGDSVARNQMESLLCILWQVEA
PVNRGSRRMSKWIFRSTSTIIVRIWSSWLVHRSTEAVGFAPKGIDKVFLDIPDETFMEFI
PRFDVLVLSSGHWFAKRSAYILNGNVVGGQLWWPRKAGNMQINNVDAFGISVETCLTALA
TNPNFTGIAIVRTYSPDHYEGGAWNTGGSCTGKTKPLDVVVRNGFTDTMYGKQVSGFTKA
VQNSGKHGSRLKLMDITEPFALRPDGHPGPYRSTDPNKKTQRGPDGRPPPQDCLHWCMPG
PVDTWNEMLLETIRREFEGVRS*

5'UTR

chr01:39857842..39857987 (+ strand) : 146 bp

chr01:39858216..39858262 (+ strand) : 47 bp

CDS

chr01:39858263..39858695 (+ strand) : 433 bp

chr01:39858851..39859128 (+ strand) : 278 bp

chr01:39860087..39860884 (+ strand) : 798 bp

3'UTR

chr01:39860885..39861282 (+ strand) : 398 bp

FASTA

>Os01t0914800-01 class=Sequence position=chr01:39857842..39861282 (+ strand)
CTAGCAGTTC TTCCTTCCGT TCCTTCCCTC TATCTATCCT CCGCCTCGTC CTCGCCACGC GCGAAGGCGG CGTCGATCGG
TTCCCCCATT TTTCTCATCG ATCCCTCGTG GCCTCCTCCC CGCCGCCGCG CCACCTCGTC TCGAAGGTAT TCTTTGTCCC
AAAACCGCCT CCTTCGCCGA CGAGCCGGTG TAGGGTGGAG ATCCAACTTG TATTTCATTT CTTTTTGTTG GGATGAACTC
CTAGGCCATA GCATCCTTGG ATTGTCTAGG GAGTTCTGCT CCGGTCTTGT TTGTTTATGT TTTGTGGGGA GGAATTTTTG
TGTCGAATTC TTCTTTGCTA CTACGCGATT AATCCGTCCT TTCTTGGTTT GCAGATTTCT TTGATGCGTG GTGGCAGTGG
CGTTTGGATC TTGGTGCCGC CATGAGTCCG CCGGGGAGGA AGGCCCCGGC CGGTGCGGGC GGGATCCGTC GGTGGCTCTC
CACCGTCGTC GTGTCGGTGG TGGCTCTTGT GCTAACCCTA GTAGTGATAT CGCTATCGGT GGGCTCGTCT CTGACCGGGG
CATCGCTACA CGAGTACCTC TTTGTCAGAC CTAGTGATTC ATCCAAGCTT ACTGATGGGA ACATGAATGG TACTGCCGTT
GGTGTTCCAT TACAAGAGGA AGTGTTGCAG GGTGGCAAGG AAGTACCCGT GGAGCACGGT GTTCAGAGTG GCGGCGTGAA
TTCGAGCGAG ACGGGTGAAA TCGATACCAA AGTACAAGAT CCAGTTGTTA CCGATGATAC CGCGTCAGTG CCTGATGAGA
GAAATCTCCC TGTCTCATCG GATTCATCCG ACAATCTTCA GAAGACTAAT GAAGGTGCGG TGTTAGTACA CTTTCCTGTT
TGTTTTCTCG GCAGCACTGA CTAACATGAA TGAGATATTG TTTTCTTGCT ATTTTAGTGT AATGGCTTGT TTGATTATTC
ATGATAATTG AATGACTGGG ATAAAAAATG GTATGGTGTA ATTGTACAGG TAGCTGTGAT CTATACCATG GACATTGGGT
TTTTGATTCT TCTGGACCAC TATACACAAA CAACTCTTGC CCGATCATCA CGCAGATGCA GAATTGTCAA GGAAATGGTC
GACCTGATAA GGATTATGAA AATTATAGAT GGAAACCAGA ACAGTGCATC CTACCACGCT TTGATGGACC AAAGTTCCTG
GAGTTGATGA GAGGCAAGAC AATTGCATTT GTTGGTGATT CAGTTGCCAG AAATCAGATG GAATCCCTCC TCTGCATTCT
GTGGCAGGTG CTGATACTAT TCATGATTTT CTTTTGGCCA TATGATTAGT TAAGCTGATG ACAAGTTGCC CATTACTATA
TATGACAATT TTTTGTTGAC CTGGATATTG ATTATTAACT TAAAATACTA GGCATTTTTG TTATTCATGT GAGTTAGGTT
TGTTACAAAC TTGTGGATGA CACCATGAAT TTTTTTATAT AGTTTTGTGA TGTTCATAAC AACATTATTT CGATTTATTT
AAAATAAATG GAGAAAGGGT CAAAGTCATT TGTTCTACAT GATTTGTTTT TAAATTGGTG AAATCTACTT ATTTTGTAGT
ACATCTGTCA GCCAAGTTTT TTGCTCGAGA TACTGCAACT GTATTGGCTG GTGTGGGTTC AGTTGCTGGA TTATTGATGT
TGTCTGATAT CAACTAGAGA AACCAATGCT GTCCTGTTGC AATCTGACAC TGTACCAATC CTATGGTTTC TAGAAGAAAA
CTGTTTTAGA GTTTAGATTT CAATCGGCTC TTTGTTTTCT CAATGTGGAC AAATTTAGGA TATTGCAAGA TTAGCCTATT
GAAAATGCCT ACCAAAGCAT CAGAACAGCA GCTAATAAGC AGAAGAATGC AAATCAATGT CCTGTAGTAC ATGATAGTCT
TTTATAGATA AGAAACTGTA TGAGTTAGAA TTGCTTTGTG AACTAATAGC ATACCTTGTG GTCTCACGTA GGAAATTTTA
TGAAGATTGA AGCAGATACC ATGTTTATTA CTTTTCCTTA TCATGCAGCA GAGTCTTGTT TTTCAAACAT CTGATTGAGA
AATCTTTTGT CGTTATATAG TGGAACACAT CTGGTTGGGC TTTCCTCCTT ACAGTAGCAG AAATGTCTCA CAAAGATCAA
CCTATACCTC TTTTCCTATG TTAAATGATT TTGTAGGCTA TGTCATTAAG AGACATGATC TGTTCTTTTA CCTTCTTTTT
GGCAGGTAGA GGCCCCAGTA AACCGTGGTA GCCGCAGGAT GAGCAAGTGG ATTTTTAGGT CAACCTCAAC AATTATCGTC
CGCATCTGGT CGTCTTGGTT AGTGCACAGG TCAACTGAAG CTGTGGGGTT TGCTCCTAAG GGTATCGATA AGGTTTTCCT
GGATATCCCG GATGAGACCT TTATGGAATT TATCCCACGT TTTGATGTGC TTGTCCTCTC CTCTGGGCAC TGGTTTGCCA
AACGGTCTGC TTATATCCTG AATGGCAATG TTGTTGGAGG GCAGCTCTGG TGGCCTCGTA AAGCTGGAAA TATGCAGATC
AACAATGTTG ATGCTTTTGG TATATCTGTT GAGACATGCC TAACTGCTCT AGCTACCAAT CCAAATTTCA CAGGTATAGC
TATCGTGCGC ACATATTCAC CAGATCATTA TGAAGGTGGG GCTTGGAATA CCGGTGGATC ATGCACTGGA AAGACTAAGC
CCTTGGATGT GGTGGTGAGG AATGGATTCA CGGACACCAT GTATGGAAAG CAGGTTTCAG GGTTCACAAA AGCAGTGCAG
AATTCTGGGA AACATGGTTC CAGGTTGAAA TTGATGGACA TCACTGAGCC CTTTGCCCTG AGGCCTGATG GGCATCCTGG
TCCATATAGA AGTACTGACC CAAACAAGAA GACGCAAAGA GGTCCAGATG GAAGGCCTCC ACCTCAGGAT TGCCTACATT
GGTGCATGCC AGGACCTGTA GATACATGGA ATGAGATGTT GCTAGAGACC ATACGAAGAG AGTTCGAGGG AGTGAGAAGC
TGAAGAAAAA CACTCATTGG CTGCTTGATT TCTATCATGT GATACGACCT GCAAAAACTA ATTAAGCTTC TAGCATTGGT
GTATACCTCA TTACATATCG TGTTGTTGTT CTCCCACAGA TAGGAAGGAA ATATAGCTTT TGGTTGGACA AAAAAACAAA
TTGTAGGCAT GTTGTCAACA GTCGGGATAG AAGTACAGAG GGGTAGACAG TTAGAGAGAG AGGTTATGAT GGATGATACT
GTGCAATTGA TCTGTATCTA GTTTTTTGTC TGACACATTC TTGGAGATAT GATCCGTTGA CGAATTTTGT GGAACTACAT
ATGATCTCAT ATCTCGAGCA CCTGTCAATC TATGAGGCAG ATGCTGATTT TGGTTTATAA CAGATGAAAG AGAACTTGTT
C