Os01t0916600-01

Locus

Os01g0916600

Description

RNA recognition motif, glycine rich protein domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

GRP1

CGSNL Gene Name

GLYCINE-RICH RNA-BINDING PROTEIN 1

Oryzabase Gene Symbol Synonym(s)

OsGRP1

Oryzabase Gene Name Synonym(s)

glycine-rich RNA-binding protein 1

Transcript Evidence

AK121668 (DDBJ, Best hit)

AK059446 (DDBJ, Best hit)

Protein Evidence

O24188 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: nucleotide binding (GO:0000166)

Molecular Function: nucleic acid binding (GO:0003676)

Functional domain (InterPro)

RNA recognition motif domain (IPR000504)

Nucleotide-binding, alpha-beta plait (IPR012677)

Full-length cDNA

J033067G16 (Online Clone Ordering)

001-028-A07 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0916600-01)

RiceXPro (AK121668)

Others

Oryzabase (8937)

KEGG (Os01t0916600-01)

Transcript

807 bp

>Os01t0916600-01 RNA recognition motif, glycine rich protein domain containing protein.
TAGCCGCCTCCGCCTCTGTAAAACCCTCAGGTCGGCCTCCCTCCTCTCCTCGTCCCTCCT
CCCCGCCGCCGCCGCAGCAGATTTAATCCTCAATGGCGGCCTTCAACAAGCTCGGTAGCT
TCCTCAGGCACAGTGGCTTGACAAGCAGTGCCTCGGCCGGCTCTTCCCCTGCCATGTTCA
ATGCTGCTCGTCTGATGTCCACCAAGCTTTTCGTTGGTGGTCTTTCTTGGAATACTAATG
ACGATTCGCTGAAAGAGGCATTCACCAGCTTCGGGGATGTGACTGAAGCTCGGGTGATCA
ATGACAGAGAATCTGGAAGGTCAAGAGGGTTTGGCTTTGTTAGCTTTGCCAATGGCGATG
ATGCCAAGAGTGCCATGGATGCCATGGACGGTAAGGAACTTGAGGGACGGAGTATCCGCG
TGAACTTCGCGAATGAGAGACCTCCAGGGAACCGAGGTGGCGGCGGGTATGGTGGTGGTG
GCGGTGGTTATGGTAACCAAGGAGGCTATGGTGATGGCAACCGAGGCTATGGAGGGCAGT
ACTAAAGTGGGCACTGACTTGCTTAAATAATGAGCTTAGGACCTGATGTGGCTTATGTGA
AGCCTTATTATTGTTTACTTTTGTACCGTTTAGTATCCGTCGTCGTTGAAATTCTAGGTG
AAGATTAAATCTTCATATTGCACTTTATATGCTTGGCGTGAAGGCCTAGGATGCGAATGG
TGCTTTTTTGTGAGTGAGAACTGAGAACACATGCATGTCTTCATATCTATTGCAATGTGT
AGAGGGTCATTACTCGAGTGTGTCAGC

CDS

453 bp

>Os01t0916600-01 RNA recognition motif, glycine rich protein domain containing protein.
ATGGCGGCCTTCAACAAGCTCGGTAGCTTCCTCAGGCACAGTGGCTTGACAAGCAGTGCC
TCGGCCGGCTCTTCCCCTGCCATGTTCAATGCTGCTCGTCTGATGTCCACCAAGCTTTTC
GTTGGTGGTCTTTCTTGGAATACTAATGACGATTCGCTGAAAGAGGCATTCACCAGCTTC
GGGGATGTGACTGAAGCTCGGGTGATCAATGACAGAGAATCTGGAAGGTCAAGAGGGTTT
GGCTTTGTTAGCTTTGCCAATGGCGATGATGCCAAGAGTGCCATGGATGCCATGGACGGT
AAGGAACTTGAGGGACGGAGTATCCGCGTGAACTTCGCGAATGAGAGACCTCCAGGGAAC
CGAGGTGGCGGCGGGTATGGTGGTGGTGGCGGTGGTTATGGTAACCAAGGAGGCTATGGT
GATGGCAACCGAGGCTATGGAGGGCAGTACTAA

Protein

151 aa

>Os01t0916600-01 RNA recognition motif, glycine rich protein domain containing protein.
MAAFNKLGSFLRHSGLTSSASAGSSPAMFNAARLMSTKLFVGGLSWNTNDDSLKEAFTSF
GDVTEARVINDRESGRSRGFGFVSFANGDDAKSAMDAMDGKELEGRSIRVNFANERPPGN
RGGGGYGGGGGGYGNQGGYGDGNRGYGGQY*

5'UTR

chr01:39954580..39954659 (+ strand) : 80 bp

chr01:39955210..39955221 (+ strand) : 12 bp

CDS

chr01:39955222..39955348 (+ strand) : 127 bp

chr01:39955435..39955503 (+ strand) : 69 bp

chr01:39955600..39955706 (+ strand) : 107 bp

chr01:39955998..39956147 (+ strand) : 150 bp

3'UTR

chr01:39956148..39956409 (+ strand) : 262 bp

FASTA

>Os01t0916600-01 class=Sequence position=chr01:39954580..39956409 (+ strand)
TAGCCGCCTC CGCCTCTGTA AAACCCTCAG GTCGGCCTCC CTCCTCTCCT CGTCCCTCCT CCCCGCCGCC GCCGCAGCAG
GTACGTCGGC ATCTCGCCTC GTTCCTCTTG GATTCCGGAT GCTCGTTCCC CGACGGATCT GGATGATCCA TTGACCCCCT
TCGCTGGATT CGGGGTCAAA TCGGTCGTTA AGGGGAGGGG GGGGGGATGG TTGGTTCATA TGTACATGCG TGTTGTTGAT
GGATTCTACT CGTTCCACCA CTAGGTAGAG GTGGGATTTG TTTGTTGTTG ATAGATTCTA CTCGTTCCAC CGCTAGGTGG
AGGTGGGGAT TTGTTCTCTG TATTTGGTTA GCTATTTTGT AACTAGTTAT GCGATTTTCG GCCTCTGATT TGGCTTAGAT
CCATGCATGA AATTGGTCAA ATCGTTTGAT TTGTTATGAT TTGTGGTTCG TTTGTAGTTG GTCCTGGTTG GTTTAGATTA
GATTGGTCGA AGACCGCTGT GAGATGAATA ATCGGCGGAA ACCATTTTTT ATGGTAGGGT TTCCCCGTAG GCCCTGGATT
GTTTGGCTGC TTATGATTAA AAATCACTGT GTACTGATGG TTAACAATGC GCGGCTACGG GTTTTCGCAG ATTTAATCCT
CAATGGCGGC CTTCAACAAG CTCGGTAGCT TCCTCAGGCA CAGTGGCTTG ACAAGCAGTG CCTCGGCCGG CTCTTCCCCT
GCCATGTTCA ATGCTGCTCG TCTGATGTCC ACCAAGCTTT TCGTTGGTGG TGAGTTTTTT GTTTTGTTGT GTTGATTCTG
ATGGTATGCA AAGTAGCATT TTTTTTACAT TGACTTATTC CCTCTTGTCT CTTAGGTCTT TCTTGGAATA CTAATGACGA
TTCGCTGAAA GAGGCATTCA CCAGCTTCGG GGATGTGACT GAAGGTCAGA TTTCTGAATA ATGTGGATAC ATCTTTTTTC
TGATGTGGTC AATGTTGTAC TTGTTTCGGG ATCTAATCAG TTATAGTTTA CGTGTTGCAG CTCGGGTGAT CAATGACAGA
GAATCTGGAA GGTCAAGAGG GTTTGGCTTT GTTAGCTTTG CCAATGGCGA TGATGCCAAG AGTGCCATGG ATGCCATGGA
CGGTAAGGTG AGTCAAGACA AGATCCACTG CTACTCCTTT TCAATTTGAG CTACTGTCCT GTATCATTGT GTTAGTTTGA
GTATGTAAGT GTATTAGAAT GTTGTGGAAT ATGTTTCAGT TCTATAACAT GTGAATACGG TTTGTTTTGA GATGCATGCT
TTTCTGGAAG TGTGTTTTAC TCTCTTTTTT TGGTTTTGCC TCACCGATGA ATGTTCTGTC TAGTTGTGCC TAAATTGTTG
AGGACAGACA TGTACCCTTG CTAGGCCTCA TTTTGTTTTG CATTTCCATT GCTTGCAGGA ACTTGAGGGA CGGAGTATCC
GCGTGAACTT CGCGAATGAG AGACCTCCAG GGAACCGAGG TGGCGGCGGG TATGGTGGTG GTGGCGGTGG TTATGGTAAC
CAAGGAGGCT ATGGTGATGG CAACCGAGGC TATGGAGGGC AGTACTAAAG TGGGCACTGA CTTGCTTAAA TAATGAGCTT
AGGACCTGAT GTGGCTTATG TGAAGCCTTA TTATTGTTTA CTTTTGTACC GTTTAGTATC CGTCGTCGTT GAAATTCTAG
GTGAAGATTA AATCTTCATA TTGCACTTTA TATGCTTGGC GTGAAGGCCT AGGATGCGAA TGGTGCTTTT TTGTGAGTGA
GAACTGAGAA CACATGCATG TCTTCATATC TATTGCAATG TGTAGAGGGT CATTACTCGA GTGTGTCAGC