Os01t0923300-01

Locus

Os01g0923300

Description

Cystathionine beta-synthase, core domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsCBSCBSPB1

Oryzabase Gene Name Synonym(s)

cystathionine b-synthase domain containing protein OsCBSCBSPB1, CBS domain containing protein OsCBSCBSPB1

Transcript Evidence

AK067520 (DDBJ, Best hit)

Protein Evidence

A3A121 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: metabolic process (GO:0008152)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

Cystathionine beta-synthase, core (IPR000644)

Aldolase-type TIM barrel (IPR013785)

Full-length cDNA

J013110E12 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0923300-01)

RiceXPro (AK067520)

Others

Oryzabase (10351)

KEGG (Os01t0923300-01)

Transcript

2060 bp

>Os01t0923300-01 Cystathionine beta-synthase, core domain containing protein.
GCAGCCTCCGGTCGCCTCCTCCGCCATCTACTCGGAGCTCCCGGATCGAGGGGAGCGCTC
GCCGCCGCCGCAGCGACCTCGCCGGATCACGGCGGCGGGGGCCGATCGATCGGAGGTCGG
TCGATTGCCTTCGGCGGGTGGGAGATGGATGGCGGCGTGGGAGGCGCGCACAGCTCGCGG
AGGAGCGTGTCCTCGTCGACCGGATCCAGGAGGAGGGCCGGGCCCACGGAGAACGGCCAC
CACGACGCCGCCGCTGCCGCCGCCGGCAGGAGGTCCTCCGCTTCCATCTCCCGCGCCTCG
CAGCAGTCGATGACCGGGGAGAGGACCGTGAAGAGGTTAAGATTGTCCAAGGCACTGACG
ATTCCGGATCACACAACCGTCTACGAGGCTTGTCGGAGGATGGCTGCACGCAGGGTGGAC
GCTGTGTTGCTGACCGACTCCAATGCTTTGCTGTGCGGGATCCTTACTGACAAGGACATA
ACCACAAGAGTAATTGCTCGCGAATTGAAGCTAGAAGAGACACCTGTTTCAAAGGTCATG
ACAAGAAATCCTCTCTTTGTTCTGTCTGACACACTCGCGGTCGAGGCATTGCAGAAGATG
GTGCAAGGTAAGTTCAGACATTTACCTGTCGTGGAGAACGGTGAAGTCATTGCACTGCTC
GACATAGCCAAGTGCCTGTATGATGCTATTGCGCGAATGGAAAGGGCAGCCGAGAAAGGA
AAAGCCATTGCTGCTGCTGTTGAGGGTGTAGAGAAGCACTGGGGAGCTTCTGTGTCTGGT
CCTAATACTTTTATTGAGACTCTTCGAGAGCGGATGTTTAGGCCATCACTATCTACCATT
ATTTCTGAGAATTCAAAGTAGAGTGGTGACTGTTGCACCAACTGACACAGTGTTGACGGC
ATCAAAAAAGATGCTTGAAGTTAAAGTAAGTTCAGCGGTTGTAGCAATTGAAAACAAGCC
TGGGGGGATTCTGACCTCTAGAGATATTTTGATGCGTGTTATAGCCCAGAATCTCCCACC
TGAATCTACTACTGTTGAGAAGGTCATGACCCAGACTCCTGAATGTGCCACGGTTGACAC
TCCAATCCTTGATGCCCTCCATACAATGCACGACGGAAAGTTTTTACATTTGCCTGTCTT
AGACAAGGATGGAAATGTTGTAACTGTAGTTGATGTCCTTCACATAACCCATGCTGCAAT
TGCAACTGTTGGAAACAGCGCGGGATCTGGATCTGAGGCGACATCAGCTATGATGCAGAG
ATTTTGGGATTCAGCAATGTCCATTGGACCTCTTGATGATGATGATGACTCCAGAAGTGA
AGGATCAACTAAAGTGGCGTCTGAGGCAACAGATGTAGGAAGATCAGCTTTTTATCCGGC
TTCTGGTTTGTCCAACACATTCGGGTTCAAGATTCAAGACAAACAAGGCAGGATGCACAG
ATTTAACTGCGAAACGAGCAGCTTGACAGAGTTGATAACCAGCATTCTACAGAGGCTTGG
CGATGACATCGATAGAAAAAACCTACCACAAATTTTGTATGAAGATGAGGATCATGATAA
GGTCATACTTTCATCGGACAGTGACCTTGTAGCTGCTGTGGACCATGCAAGGCAAATCGG
TTGGAAGAGCTTGAAGTTGCACTTGGATTACGCCGGTGTTGGTCGCCGGAAGAGAGGCGG
TGGTGGCACTTCAGACTTCGAGTACGCTGGAAAGGATGCGTGGGCTTCAGCCTACAGCGC
TGTGGCTGCAGGAGCAGCTCTTGTTGCAGGCCTTGGCGTGATGGCTTACCTGAAGAGAGC
AGGCTAGGCTTGCAGCTTTGCAGTTGCAGATGCAGATGCAGATGAGGCTTTCATCTTGTG
ATGATGATGATACGAAATGTTACAGAATCAAATTTGAGCAGATTGGTGTGTAAATTAATT
CTTGTGGGGAAAAAAATCTGTAATAATCTCACGGCAGCGGATGGCTGCCTACATATAATG
ACGAAATTTTCCGGTGGCTAAAAAAATGTCTGGTATTCAGCTTGTATCGCCACTGTACAA
TGAAGCAAATGCTCTGTACT

CDS

717 bp

>Os01t0923300-01 Cystathionine beta-synthase, core domain containing protein.
ATGGATGGCGGCGTGGGAGGCGCGCACAGCTCGCGGAGGAGCGTGTCCTCGTCGACCGGA
TCCAGGAGGAGGGCCGGGCCCACGGAGAACGGCCACCACGACGCCGCCGCTGCCGCCGCC
GGCAGGAGGTCCTCCGCTTCCATCTCCCGCGCCTCGCAGCAGTCGATGACCGGGGAGAGG
ACCGTGAAGAGGTTAAGATTGTCCAAGGCACTGACGATTCCGGATCACACAACCGTCTAC
GAGGCTTGTCGGAGGATGGCTGCACGCAGGGTGGACGCTGTGTTGCTGACCGACTCCAAT
GCTTTGCTGTGCGGGATCCTTACTGACAAGGACATAACCACAAGAGTAATTGCTCGCGAA
TTGAAGCTAGAAGAGACACCTGTTTCAAAGGTCATGACAAGAAATCCTCTCTTTGTTCTG
TCTGACACACTCGCGGTCGAGGCATTGCAGAAGATGGTGCAAGGTAAGTTCAGACATTTA
CCTGTCGTGGAGAACGGTGAAGTCATTGCACTGCTCGACATAGCCAAGTGCCTGTATGAT
GCTATTGCGCGAATGGAAAGGGCAGCCGAGAAAGGAAAAGCCATTGCTGCTGCTGTTGAG
GGTGTAGAGAAGCACTGGGGAGCTTCTGTGTCTGGTCCTAATACTTTTATTGAGACTCTT
CGAGAGCGGATGTTTAGGCCATCACTATCTACCATTATTTCTGAGAATTCAAAGTAG

Protein

239 aa

>Os01t0923300-01 Cystathionine beta-synthase, core domain containing protein.
MDGGVGGAHSSRRSVSSSTGSRRRAGPTENGHHDAAAAAAGRRSSASISRASQQSMTGER
TVKRLRLSKALTIPDHTTVYEACRRMAARRVDAVLLTDSNALLCGILTDKDITTRVIARE
LKLEETPVSKVMTRNPLFVLSDTLAVEALQKMVQGKFRHLPVVENGEVIALLDIAKCLYD
AIARMERAAEKGKAIAAAVEGVEKHWGASVSGPNTFIETLRERMFRPSLSTIISENSK*

5'UTR

chr01:40385339..40385482 (+ strand) : 144 bp

CDS

chr01:40385483..40385643 (+ strand) : 161 bp

chr01:40386109..40386277 (+ strand) : 169 bp

chr01:40386367..40386499 (+ strand) : 133 bp

chr01:40386582..40386752 (+ strand) : 171 bp

chr01:40386936..40387018 (+ strand) : 83 bp

3'UTR

chr01:40387118..40387231 (+ strand) : 114 bp

chr01:40387305..40387371 (+ strand) : 67 bp

chr01:40387460..40387565 (+ strand) : 106 bp

chr01:40387650..40387708 (+ strand) : 59 bp

chr01:40387899..40388008 (+ strand) : 110 bp

chr01:40388096..40388229 (+ strand) : 134 bp

chr01:40388358..40388443 (+ strand) : 86 bp

chr01:40388571..40388660 (+ strand) : 90 bp

chr01:40388745..40389177 (+ strand) : 433 bp

FASTA

>Os01t0923300-01 class=Sequence position=chr01:40385339..40389177 (+ strand)
GCAGCCTCCG GTCGCCTCCT CCGCCATCTA CTCGGAGCTC CCGGATCGAG GGGAGCGCTC GCCGCCGCCG CAGCGACCTC
GCCGGATCAC GGCGGCGGGG GCCGATCGAT CGGAGGTCGG TCGATTGCCT TCGGCGGGTG GGAGATGGAT GGCGGCGTGG
GAGGCGCGCA CAGCTCGCGG AGGAGCGTGT CCTCGTCGAC CGGATCCAGG AGGAGGGCCG GGCCCACGGA GAACGGCCAC
CACGACGCCG CCGCTGCCGC CGCCGGCAGG AGGTCCTCCG CTTCCATCTC CCGCGCCTCG CAGCAGTACG GACTCCCCGC
CTCGCCCTTT CTGTTTTTCT TTTTTTTTTT TGGTAGTATT ACTTCTCTTG GATTGGGAGA TGCTGTAGGT GGCGGAGAAG
CGTGGGATTC AGGCGTTGCC TTGGGGTTGA TAGTTAGGCC TTTTAGGGGG GATACTTTTA TTTGGTGTCG CTTTGTTTGC
AACCTAGGCT AGATTTGATC TGATGGAATA ACAAAAAAGA TTACGACACA GTAGCACTAC GAACTAGAAA ACTGAAGAAT
ACAAATCCAA TTAATCTGTT ATAATGATGT ATGAATGCTA CTAGTAGTTT GTTGAATTTT AATTCGGTAA CGCAGATAAC
TTCATTTACA ATTTACAAGC AAGCTTGTCT TCAATATGAC ATGCATAACC GGTTAATAGT GCATTGATGC GAAGTGAGTA
AAACCGAAAT GCTAGCGGGC AGCATTGCAA CTGAAGAGTA TTTGCCTCAG GTCGATGACC GGGGAGAGGA CCGTGAAGAG
GTTAAGATTG TCCAAGGCAC TGACGATTCC GGATCACACA ACCGTCTACG AGGCTTGTCG GAGGATGGCT GCACGCAGGG
TGGACGCTGT GTTGCTGACC GACTCCAATG CTTTGCTGTG CGGGATCCTT ACTGACAAGG TGATGAGGAT TTTCTTTGAT
GTATGTCCTC AATAGGTGTT GAATTGGAAA ATTATTCATT TCTCACTCTT TTGCTAACCT CCAATCAGGA CATAACCACA
AGAGTAATTG CTCGCGAATT GAAGCTAGAA GAGACACCTG TTTCAAAGGT CATGACAAGA AATCCTCTCT TTGTTCTGTC
TGACACACTC GCGGTCGAGG CATTGCAGAA GATGGTGCAA GGTGGGTGAA GTCCCAAACA CTATCTCTGG TCCCTTGTTT
GCACTTCTCT TGATTTTCCT GAGAATGTAT CACTTCATTC CAGGTAAGTT CAGACATTTA CCTGTCGTGG AGAACGGTGA
AGTCATTGCA CTGCTCGACA TAGCCAAGTG CCTGTATGAT GCTATTGCGC GAATGGAAAG GGCAGCCGAG AAAGGAAAAG
CCATTGCTGC TGCTGTTGAG GGTGTAGAGA AGCACTGGGG AGCTTCTGTG TCTGGTCTGT ACTTGATCAC ATTGTCCTTT
TCCTCCTGAT TCTGCCTGTT TTAAAAAGAC ATTCTGTTAT GTTCCACCTG CTTCTTATAT TGTCATGTAT TGGTTACTTC
TATGATAAAC TTTACTGCCT GAAGTTTTAG GCTTTTTCTA GCATGCATTA TTAACACTTT CTCCATTTAC TTTGCAGGTC
CTAATACTTT TATTGAGACT CTTCGAGAGC GGATGTTTAG GCCATCACTA TCTACCATTA TTTCTGAGAA TTCAAAGTAG
GTAATATCCA TTCCTTTTTC AAGTTTTAGG CTTTTCCAGC ATTTCAGGAA TTTAAGTGCC ATTGTTGAAC AACTGACTTA
TTGCTGACAA ACTTCTTAGA GTGGTGACTG TTGCACCAAC TGACACAGTG TTGACGGCAT CAAAAAAGAT GCTTGAAGTT
AAAGTAAGTT CAGCGGTTGT AGCAATTGAA AACAAGCCTG GGGGGATTCT GACGTGAGTA TCTCTTCTCA GTTTAATTAT
ACCATTTTGA CTGTTGAACT AACATCTGCT ATCTTTCTTA CATCAGCTCT AGAGATATTT TGATGCGTGT TATAGCCCAG
AATCTCCCAC CTGAATCTAC TACTGTTGAG AAGGTAAGGA AGTCTTAACA TGGAATGTCT GCTATGTTTT TCTTAATCTC
TTTAACTATC ATGGCATCAT GCTTGAAACT CCTTTCTACA GGTCATGACC CAGACTCCTG AATGTGCCAC GGTTGACACT
CCAATCCTTG ATGCCCTCCA TACAATGCAC GACGGAAAGT TTTTACATTT GCCTGTCTTA GACAAGGGTA TGTCCATGTA
GTGCAATGGA TTATATCTAA TTTATTTATT GGAGGTCTAC TAAGTTGTTG ACATGTGTTG TCTATATCCA GATGGAAATG
TTGTAACTGT AGTTGATGTC CTTCACATAA CCCATGCTGC AATTGCAACT GTAAGTGAAA AGTTCCAGCT GCTTGATATA
TTTTCTCTGT GTCCTTGTGC ATACAGTCTT ACACAATACT CACTTTGTCA GCATGCATTG TAAAATGCTG AGAGAATGCA
TCACGATGTG GAACCTGTCA TTATTACATG TCTTTTGCTT TCATTCTATT AAGATGGATT GAGTATCATG CTGTATGCAG
GTTGGAAACA GCGCGGGATC TGGATCTGAG GCGACATCAG CTATGATGCA GAGATTTTGG GATTCAGCAA TGTCCATTGG
ACCTCTTGAT GATGATGATG ACTCCAGAAG GTTAGTATCT TTGCTTATAT CTTATCATTT TGATAATCTG ATGGCATGGT
TCTGTCATGA TTTATAATTC ACTTGGCATA TTATCAGTGA AGGATCAACT AAAGTGGCGT CTGAGGCAAC AGATGTAGGA
AGATCAGCTT TTTATCCGGC TTCTGGTTTG TCCAACACAT TCGGGTTCAA GATTCAAGAC AAACAAGGCA GGATGCACAG
ATTTAACTGC GGTATGCATC TTAGTTTCAT GCCAACAGGG AATTGTGTTA TCAATGTTCT TTCTGCCCTT CCTTTTGTTG
TATTTCTAAT TATTTATATT GTATCCTTGG TTTCATGTGT GATATGCTTC AAACTTCAGA AACGAGCAGC TTGACAGAGT
TGATAACCAG CATTCTACAG AGGCTTGGCG ATGACATCGA TAGAAAAAAC CTACCACAAA TTTTGGTAAG GACTCAGCTC
CCTCCTCAAC ATGTACCCAC ACAGGCAGTA CCAGTATGAT AACTCCCTTC CTCGAAAAGA AAGTATGATA ATTCTCTAAG
GCTTCCTTTT CTTTCGTTAC ACCATGTGGC AGTATGAAGA TGAGGATCAT GATAAGGTCA TACTTTCATC GGACAGTGAC
CTTGTAGCTG CTGTGGACCA TGCAAGGCAA ATCGGTTGGA AGGTAATTCT CTTTCAGTTT AAGATAGTAG TTCTTTTCCC
CTCCCCTGCC AGCCAAACGG TGCTCATCTC TGACCCCATC TTGCAGAGCT TGAAGTTGCA CTTGGATTAC GCCGGTGTTG
GTCGCCGGAA GAGAGGCGGT GGTGGCACTT CAGACTTCGA GTACGCTGGA AAGGATGCGT GGGCTTCAGC CTACAGCGCT
GTGGCTGCAG GAGCAGCTCT TGTTGCAGGC CTTGGCGTGA TGGCTTACCT GAAGAGAGCA GGCTAGGCTT GCAGCTTTGC
AGTTGCAGAT GCAGATGCAG ATGAGGCTTT CATCTTGTGA TGATGATGAT ACGAAATGTT ACAGAATCAA ATTTGAGCAG
ATTGGTGTGT AAATTAATTC TTGTGGGGAA AAAAATCTGT AATAATCTCA CGGCAGCGGA TGGCTGCCTA CATATAATGA
CGAAATTTTC CGGTGGCTAA AAAAATGTCT GGTATTCAGC TTGTATCGCC ACTGTACAAT GAAGCAAATG CTCTGTACT

Locus: Os01g0923300

Loading...

Locus: Os01g0923300

Loading...