Os01t0924400-01

Locus

Os01g0924400

Description

Similar to Auxin-induced basic helix-loop-helix transcription factor.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsTCP6, TCP6

Oryzabase Gene Name Synonym(s)

TEOSINTE BRANCHED/CYCLOIDEA/PROLIFERATING CELL FACTOR 6

Transcript Evidence

AK072037 (DDBJ, Best hit)

Protein Evidence

B6U2U5 (UniProt)

Literature

Note

Manual Curation

Functional domain (InterPro)

Transcription factor, TCP (IPR005333)

Transcription factor TCP subgroup (IPR017887)

Full-length cDNA

J013106J07 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0924400-01)

RiceXPro (AK072037)

Others

Oryzabase (12393)

KEGG (Os01t0924400-01)

Transcript

1854 bp

>Os01t0924400-01 Similar to Auxin-induced basic helix-loop-helix transcription factor.
AAGATTTTCTTATTCTTCTTCTTCTCCTCCTCTCTCTTCTCCTCTTCTTGCACCTCCTCA
CCTTCTCCTCTCCTCTCCTCTTCTTCTCCATCACCATCCACCCATCCAACTGGTCCAACT
CCTCCAATCGTTTGCTTCTTCTTCTTCCTCTTCTCGCTGTTCTTGGTGGAGGAGGAGATT
AGGGTTTGATTAGGGTAGATAGAGAGAGAGGGGTTGGGTTTGGTTGGTGTTTGTGTGGAG
ATGGACCCCAAATTCCCCCCACCCCCACCGCTAAACAAAACGGAGCCCACCACCACCACC
ACCAACCAGCAGCATCACCACGATGAGCAGCAGCAGCAGCATCGCCTCCAGATTCAAGTT
CATCCTCAGCAGCAGGAGCAGCAGGATGGAGGTGGAGGAGGAGGGAAGGATCAGCAGCAG
CAGCAGCAGATGCAGGTGGTGGTTGCGGCGGCGGCGGGGGAGAGGAGGATGCAGGGGCTA
GGGCCGAAGCGGAGCTCGAACAAGGACCGCCACACCAAGGTGGACGGGCGGGGGCGGCGG
ATCCGGATGCCGGCGCTGTGCGCCGCCCGGATCTTCCAGCTCACGCGGGAGCTCGGCCAC
AAGTCCGACGGCGAGACCGTCCAGTGGCTGCTCCAGCAGGCGGAGCCGGCCATCGTCGCC
GCCACGGGGACCGGGACCATCCCGGCGTCCGCGCTCGCCTCCGTCGCCCCCTCCCTCCCT
TCCCCCAACTCCGCCCTCTCCAGGTCGCACCACCACCACCACCACATGTGGGCGGCAGCG
CCGCCCACGGCGTCCGCCGGGTTCGCCGGTGCAGGGTTCTCCGGCGCCGACTCCGGGGTG
ATCGGCGGGATCATGCAGCGGATGGGGATCCCCGCCGGGATCGAGCTCCAGGGCGGGGGA
GCGGGGGGGTTGGGGGGTGGGGGTGGCGGCGGCGGTGGCCACATCGGGTTCGCGCCCATG
TTCGCCAGCCACGCGGCGGCGGCGGCGGCCATGCCGGGGCTAGAGCTAGGGCTCTCGCAG
GACGGCCACATCGGCGTGCTCGCCGCGCAGTCGCTCAGCCAGTTCTACCACCAGGTCGGC
GCCGCCGGTCAGCTGCAGCACCAGCACCAGCATCACCATCAGCAGCAGCAGCAGCAGCAG
GACGGGGAGGACAACCGCGACGACGGCGAGTCCGATGAGGAGTCCGGGCAGTAGTAGCCG
CGCCACCTGAATTTGTTCATCCACGCGTCGTCTCTTCGGAGGAGAAAAGAGAATTCTAGG
AAGGACATGCAGCTAATGGAGGGGGGAATGGAATGCTTTTGTTACTGTTGGGTTGTTCTT
CATGGGGGTTTTTATGTCTGATTTTTTTTCCTCGTGTGGTGTCGAAGCTCGAAAGAGGCT
ACTACTTTGCTCCGGCGACTTGTTGGGATGGATCATGATCATCTTCAGTTGTTACTCCTG
CTGCTCCATGGATGGTTGCCGGTTTATCCCCCTCCAAGTGTTTAGGTGAAAGCTCAATAT
TTCGCACTCGACAGTCAACACATGACATGATCTTCGAAAGGTTGCTTGATGAGCTTATGT
ATCTGTGTTTGTGTTCATTTTTGCAGGTGTATAATAGCCGAGAGCTGGATGGACTGGATC
ATCGCTGTCGAGTGAGTGCTTTATTTGTTATTGCAGGTCGTTGTGTAGATATTCAGGTAT
TTTTGCAGTTAGAGAGGTCTTCTTTTTTTCCTTTTTACGAGAGTGATGATCCGCTTATGT
GCGACAAATACGATGTCCGTCAAACTGATCCTCACCCACGGGCTGTTTCTGCAACGCAAA
TATGATGCATATACATTTTTAGAGGCCTGATTTTATATGCTTATTCTTTTGTGG

CDS

954 bp

>Os01t0924400-01 Similar to Auxin-induced basic helix-loop-helix transcription factor.
ATGGACCCCAAATTCCCCCCACCCCCACCGCTAAACAAAACGGAGCCCACCACCACCACC
ACCAACCAGCAGCATCACCACGATGAGCAGCAGCAGCAGCATCGCCTCCAGATTCAAGTT
CATCCTCAGCAGCAGGAGCAGCAGGATGGAGGTGGAGGAGGAGGGAAGGATCAGCAGCAG
CAGCAGCAGATGCAGGTGGTGGTTGCGGCGGCGGCGGGGGAGAGGAGGATGCAGGGGCTA
GGGCCGAAGCGGAGCTCGAACAAGGACCGCCACACCAAGGTGGACGGGCGGGGGCGGCGG
ATCCGGATGCCGGCGCTGTGCGCCGCCCGGATCTTCCAGCTCACGCGGGAGCTCGGCCAC
AAGTCCGACGGCGAGACCGTCCAGTGGCTGCTCCAGCAGGCGGAGCCGGCCATCGTCGCC
GCCACGGGGACCGGGACCATCCCGGCGTCCGCGCTCGCCTCCGTCGCCCCCTCCCTCCCT
TCCCCCAACTCCGCCCTCTCCAGGTCGCACCACCACCACCACCACATGTGGGCGGCAGCG
CCGCCCACGGCGTCCGCCGGGTTCGCCGGTGCAGGGTTCTCCGGCGCCGACTCCGGGGTG
ATCGGCGGGATCATGCAGCGGATGGGGATCCCCGCCGGGATCGAGCTCCAGGGCGGGGGA
GCGGGGGGGTTGGGGGGTGGGGGTGGCGGCGGCGGTGGCCACATCGGGTTCGCGCCCATG
TTCGCCAGCCACGCGGCGGCGGCGGCGGCCATGCCGGGGCTAGAGCTAGGGCTCTCGCAG
GACGGCCACATCGGCGTGCTCGCCGCGCAGTCGCTCAGCCAGTTCTACCACCAGGTCGGC
GCCGCCGGTCAGCTGCAGCACCAGCACCAGCATCACCATCAGCAGCAGCAGCAGCAGCAG
GACGGGGAGGACAACCGCGACGACGGCGAGTCCGATGAGGAGTCCGGGCAGTAG

Protein

318 aa

>Os01t0924400-01 Similar to Auxin-induced basic helix-loop-helix transcription factor.
MDPKFPPPPPLNKTEPTTTTTNQQHHHDEQQQQHRLQIQVHPQQQEQQDGGGGGGKDQQQ
QQQMQVVVAAAAGERRMQGLGPKRSSNKDRHTKVDGRGRRIRMPALCAARIFQLTRELGH
KSDGETVQWLLQQAEPAIVAATGTGTIPASALASVAPSLPSPNSALSRSHHHHHHMWAAA
PPTASAGFAGAGFSGADSGVIGGIMQRMGIPAGIELQGGGAGGLGGGGGGGGGHIGFAPM
FASHAAAAAAMPGLELGLSQDGHIGVLAAQSLSQFYHQVGAAGQLQHQHQHHHQQQQQQQ
DGEDNRDDGESDEESGQ*

5'UTR

chr01:40477240..40477479 (+ strand) : 240 bp

CDS

chr01:40477480..40478433 (+ strand) : 954 bp

3'UTR

chr01:40478434..40479093 (+ strand) : 660 bp

FASTA

>Os01t0924400-01 class=Sequence position=chr01:40477240..40479093 (+ strand)
AAGATTTTCT TATTCTTCTT CTTCTCCTCC TCTCTCTTCT CCTCTTCTTG CACCTCCTCA CCTTCTCCTC TCCTCTCCTC
TTCTTCTCCA TCACCATCCA CCCATCCAAC TGGTCCAACT CCTCCAATCG TTTGCTTCTT CTTCTTCCTC TTCTCGCTGT
TCTTGGTGGA GGAGGAGATT AGGGTTTGAT TAGGGTAGAT AGAGAGAGAG GGGTTGGGTT TGGTTGGTGT TTGTGTGGAG
ATGGACCCCA AATTCCCCCC ACCCCCACCG CTAAACAAAA CGGAGCCCAC CACCACCACC ACCAACCAGC AGCATCACCA
CGATGAGCAG CAGCAGCAGC ATCGCCTCCA GATTCAAGTT CATCCTCAGC AGCAGGAGCA GCAGGATGGA GGTGGAGGAG
GAGGGAAGGA TCAGCAGCAG CAGCAGCAGA TGCAGGTGGT GGTTGCGGCG GCGGCGGGGG AGAGGAGGAT GCAGGGGCTA
GGGCCGAAGC GGAGCTCGAA CAAGGACCGC CACACCAAGG TGGACGGGCG GGGGCGGCGG ATCCGGATGC CGGCGCTGTG
CGCCGCCCGG ATCTTCCAGC TCACGCGGGA GCTCGGCCAC AAGTCCGACG GCGAGACCGT CCAGTGGCTG CTCCAGCAGG
CGGAGCCGGC CATCGTCGCC GCCACGGGGA CCGGGACCAT CCCGGCGTCC GCGCTCGCCT CCGTCGCCCC CTCCCTCCCT
TCCCCCAACT CCGCCCTCTC CAGGTCGCAC CACCACCACC ACCACATGTG GGCGGCAGCG CCGCCCACGG CGTCCGCCGG
GTTCGCCGGT GCAGGGTTCT CCGGCGCCGA CTCCGGGGTG ATCGGCGGGA TCATGCAGCG GATGGGGATC CCCGCCGGGA
TCGAGCTCCA GGGCGGGGGA GCGGGGGGGT TGGGGGGTGG GGGTGGCGGC GGCGGTGGCC ACATCGGGTT CGCGCCCATG
TTCGCCAGCC ACGCGGCGGC GGCGGCGGCC ATGCCGGGGC TAGAGCTAGG GCTCTCGCAG GACGGCCACA TCGGCGTGCT
CGCCGCGCAG TCGCTCAGCC AGTTCTACCA CCAGGTCGGC GCCGCCGGTC AGCTGCAGCA CCAGCACCAG CATCACCATC
AGCAGCAGCA GCAGCAGCAG GACGGGGAGG ACAACCGCGA CGACGGCGAG TCCGATGAGG AGTCCGGGCA GTAGTAGCCG
CGCCACCTGA ATTTGTTCAT CCACGCGTCG TCTCTTCGGA GGAGAAAAGA GAATTCTAGG AAGGACATGC AGCTAATGGA
GGGGGGAATG GAATGCTTTT GTTACTGTTG GGTTGTTCTT CATGGGGGTT TTTATGTCTG ATTTTTTTTC CTCGTGTGGT
GTCGAAGCTC GAAAGAGGCT ACTACTTTGC TCCGGCGACT TGTTGGGATG GATCATGATC ATCTTCAGTT GTTACTCCTG
CTGCTCCATG GATGGTTGCC GGTTTATCCC CCTCCAAGTG TTTAGGTGAA AGCTCAATAT TTCGCACTCG ACAGTCAACA
CATGACATGA TCTTCGAAAG GTTGCTTGAT GAGCTTATGT ATCTGTGTTT GTGTTCATTT TTGCAGGTGT ATAATAGCCG
AGAGCTGGAT GGACTGGATC ATCGCTGTCG AGTGAGTGCT TTATTTGTTA TTGCAGGTCG TTGTGTAGAT ATTCAGGTAT
TTTTGCAGTT AGAGAGGTCT TCTTTTTTTC CTTTTTACGA GAGTGATGAT CCGCTTATGT GCGACAAATA CGATGTCCGT
CAAACTGATC CTCACCCACG GGCTGTTTCT GCAACGCAAA TATGATGCAT ATACATTTTT AGAGGCCTGA TTTTATATGC
TTATTCTTTT GTGG

Locus: Os01g0924400

Loading...

Locus: Os01g0924400

Loading...