Os01t0925400-01

Locus

Os01g0925400

Description

No apical meristem (NAM) protein domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

NAC41

CGSNL Gene Name

NAC DOMAIN-CONTAINING PROTEIN 41

Oryzabase Gene Symbol Synonym(s)

ONAC041, ONAC41, ONAC050, ONAC50

Oryzabase Gene Name Synonym(s)

NAC domain-containing protein 041, NAC domain-containing protein 41, NAC domain-containing protein 50

Transcript Evidence

AK068446 (DDBJ, Best hit)

AK067450 (DDBJ, Best hit)

Protein Evidence

NP_001151237.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Functional domain (InterPro)

No apical meristem (NAM) protein (IPR003441)

Full-length cDNA

J013153H06 (Online Clone Ordering)

J013106M04 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0925400-01)

RiceXPro (AK068446)

Others

Oryzabase (11481)

KEGG (Os01t0925400-01)

Transcript

902 bp

>Os01t0925400-01 No apical meristem (NAM) protein domain containing protein.
AACTACTCCTCCACCTCTTACCTGACATGTAATAAGCGAGCTGACCAACAAACCCAACCC
CGACCCGCGCCGCCGCCCGCCAGCGAGGTCGTCGCCGGCGTCTAAGCTCTCATTCATGGC
GGCGGAGGCGGCCTCCGGTGGCGGTGGTGGGTACCGGATGCTGCCGCaggcggggttgcc
gatcggtttccggttccgacccaccgacgaggagctcctgctccactacctccgccgcaa
ggtcatgtcgcgccccctccccgccgacgtcatccccgtcgccgacctcgcccgcctcca
tccatgggaccttccagGCGAGGGAGACGGCGAGAGGTACTTCTTCCACCTGCCGGCGAC
GAGCTGCTGGCGGAGGGGCGGCGGCGGGAGCAGGGCGGGCGGCGGCGGCGGCGCGTGGAG
GGCGTCCGGGAAGGAGAAGCTCGTcgtcgcgccgcgctgcggcaagcggcccgtcggcgc
caagcggacgctcgtcttcttccgccgcggcggcgcccgcaccgactgggccatgcacga
gtaccgcctcctccccgccgacgaccatccgccggaggccaacgacgtctgggtggtctg
ccgcgtattcaagaagaccaccacgctggctcaccgccgttcgccgccgtccatccgtgg
cgcgccacgccggcgagccgccgccgccgacGACGACGACATGCCGTCCTCGCCGTCGTC
CTGCGTGACGGACGGCGGCGACGCGGGGGAGGAGGGAGAAGAGAGCAGCAGCTGCAGCGT
CGTCGCTTCTAATTGTCCATGAGATGATCAGATGAGAGAGGGAGAGGTTTTACCGTGTTA
GTGTTTGACTAGGCCGTTAATTACCATGCTTTCATGTCCTAATCAGCGCCCTTCTTTTGC
TC

CDS

687 bp

>Os01t0925400-01 No apical meristem (NAM) protein domain containing protein.
ATGGCGGCGGAGGCGGCCTCCGGTGGCGGTGGTGGGTACCGGATGCTGCCGCaggcgggg
ttgccgatcggtttccggttccgacccaccgacgaggagctcctgctccactacctccgc
cgcaaggtcatgtcgcgccccctccccgccgacgtcatccccgtcgccgacctcgcccgc
ctccatccatgggaccttccagGCGAGGGAGACGGCGAGAGGTACTTCTTCCACCTGCCG
GCGACGAGCTGCTGGCGGAGGGGCGGCGGCGGGAGCAGGGCGGGCGGCGGCGGCGGCGCG
TGGAGGGCGTCCGGGAAGGAGAAGCTCGTcgtcgcgccgcgctgcggcaagcggcccgtc
ggcgccaagcggacgctcgtcttcttccgccgcggcggcgcccgcaccgactgggccatg
cacgagtaccgcctcctccccgccgacgaccatccgccggaggccaacgacgtctgggtg
gtctgccgcgtattcaagaagaccaccacgctggctcaccgccgttcgccgccgtccatc
cgtggcgcgccacgccggcgagccgccgccgccgacGACGACGACATGCCGTCCTCGCCG
TCGTCCTGCGTGACGGACGGCGGCGACGCGGGGGAGGAGGGAGAAGAGAGCAGCAGCTGC
AGCGTCGTCGCTTCTAATTGTCCATGA

Protein

229 aa

>Os01t0925400-01 No apical meristem (NAM) protein domain containing protein.
MAAEAASGGGGGYRMLPQAGLPIGFRFRPTDEELLLHYLRRKVMSRPLPADVIPVADLAR
LHPWDLPGEGDGERYFFHLPATSCWRRGGGGSRAGGGGGAWRASGKEKLVVAPRCGKRPV
GAKRTLVFFRRGGARTDWAMHEYRLLPADDHPPEANDVWVVCRVFKKTTTLAHRRSPPSI
RGAPRRRAAAADDDDMPSSPSSCVTDGGDAGEEGEESSSCSVVASNCP*

5'UTR

chr01:40572822..40572936 (+ strand) : 115 bp

CDS

chr01:40572937..40573138 (+ strand) : 202 bp

chr01:40573232..40573716 (+ strand) : 485 bp

3'UTR

chr01:40573717..40573816 (+ strand) : 100 bp

FASTA

>Os01t0925400-01 class=Sequence position=chr01:40572822..40573816 (+ strand)
AACTACTCCT CCACCTCTTA CCTGACATGT AATAAGCGAG CTGACCAACA AACCCAACCC CGACCCGCGC CGCCGCCCGC
CAGCGAGGTC GTCGCCGGCG TCTAAGCTCT CATTCATGGC GGCGGAGGCG GCCTCCGGTG GCGGTGGTGG GTACCGGATG
CTGCCGCagg cggggttgcc gatcggtttc cggttccgac ccaccgacga ggagctcctg ctccactacc tccgccgcaa
ggtcatgtcg cgccccctcc ccgccgacgt catccccgtc gccgacctcg cccgcctcca tccatgggac cttccaggta
CGCGCGCGGC CACGATCATG GCGCTAGCTT CTTCGTTTTT GGGGGGTTTT GGCATTGCGT TGACGAGCAT CGGTGGCGGA
TTATTTACAG GCGAGGGAGA CGGCGAGAGG TACTTCTTCC ACCTGCCGGC GACGAGCTGC TGGCGGAGGG GCGGCGGCGG
GAGCAGGGCG GGCGGCGGCG GCGGCGCGTG GAGGGCGTCC GGGAAGGAGA AGCTCGTcgt cgcgccgcgc tgcggcaagc
ggcccgtcgg cgccaagcgg acgctcgtct tcttccgccg cggcggcgcc cgcaccgact gggccatgca cgagtaccgc
ctcctccccg ccgacgacca tccgccggag gccaacgacg tctgggtggt ctgccgcgta ttcaagaaga ccaccacgct
ggctcaccgc cgttcgccgc cgtccatccg tggcgcgcca cgccggcgag ccgccgccgc cgacGACGAC GACATGCCGT
CCTCGCCGTC GTCCTGCGTG ACGGACGGCG GCGACGCGGG GGAGGAGGGA GAAGAGAGCA GCAGCTGCAG CGTCGTCGCT
TCTAATTGTC CATGAGATGA TCAGATGAGA GAGGGAGAGG TTTTACCGTG TTAGTGTTTG ACTAGGCCGT TAATTACCAT
GCTTTCATGT CCTAATCAGC GCCCTTCTTT TGCTC

Locus: Os01g0925400

Loading...

Locus: Os01g0925400

Loading...