Os01t0935100-00

Locus

Os01g0935100

Description

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

HAP3J

CGSNL Gene Name

HAP3J SUBUNIT OF CCAAT-BOX BINDING COMPLEX

Oryzabase Gene Symbol Synonym(s)

OsHAP3J, NF-YB, CBF-A, OsNF-YB5, NF-YB5, NF-YB5

Oryzabase Gene Name Synonym(s)

NUCLEAR FACTOR-Y subunit B5, NUCLEAR FACTOR-Y subunit NF-YB5, NF-YB subunit 5, NF-YB family 5

Transcript Evidence

Protein Evidence

Literature

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Expression Databases

TENOR (Os01t0935100-00)

Others

Oryzabase (8489)

Transcript

435 bp

>Os01t0935100-00
ATGACGAACGGGCAGGACAACCTGCTGCCGATCGCCAACGTGGGCCGGATCATGAAGGAC
GGGCTGCCGCCGCAGGCGAAGATATCGAAGCGGGCCAAGGAGACGATCCAGGAGTGCGCG
ACGGAGTTCATCAGCTTCGTCACCGGCGAGGCGTCGGAGCGGTGCCGGCGGGAGCGGCGG
AAGACGGTGAACGGCGACGACGTCTGCCACGCCATGAGGAGCCTCGGCCTCGACCACTAC
GCCGACGCCATGCACAGGTACCTGCAGAGGTACCGCGAGGGCGAGGAGCTCGCCGCGTCG
CTCAACAGCAGCAGCAGCGCCGCCGCCGCCGCCGCCGCCGCCGGCAGCAGGGGCGGTGGC
GCCATACAGATCGACGTGAGAGCTGAGCTCTCCATCTTCAGATCAGGCAACAACCAAGGT
CGTCCAAACAATTAA

CDS

435 bp

>Os01t0935100-00
ATGACGAACGGGCAGGACAACCTGCTGCCGATCGCCAACGTGGGCCGGATCATGAAGGAC
GGGCTGCCGCCGCAGGCGAAGATATCGAAGCGGGCCAAGGAGACGATCCAGGAGTGCGCG
ACGGAGTTCATCAGCTTCGTCACCGGCGAGGCGTCGGAGCGGTGCCGGCGGGAGCGGCGG
AAGACGGTGAACGGCGACGACGTCTGCCACGCCATGAGGAGCCTCGGCCTCGACCACTAC
GCCGACGCCATGCACAGGTACCTGCAGAGGTACCGCGAGGGCGAGGAGCTCGCCGCGTCG
CTCAACAGCAGCAGCAGCGCCGCCGCCGCCGCCGCCGCCGCCGGCAGCAGGGGCGGTGGC
GCCATACAGATCGACGTGAGAGCTGAGCTCTCCATCTTCAGATCAGGCAACAACCAAGGT
CGTCCAAACAATTAA

Protein

145 aa

>Os01t0935100-00
MTNGQDNLLPIANVGRIMKDGLPPQAKISKRAKETIQECATEFISFVTGEASERCRRERR
KTVNGDDVCHAMRSLGLDHYADAMHRYLQRYREGEELAASLNSSSSAAAAAAAAGSRGGG
AIQIDVRAELSIFRSGNNQGRPNN*

CDS

chr01:41021478..41021912 (- strand) : 435 bp

FASTA

>Os01t0935100-00 class=Sequence position=chr01:41021478..41021912 (- strand)
ATGACGAACG GGCAGGACAA CCTGCTGCCG ATCGCCAACG TGGGCCGGAT CATGAAGGAC GGGCTGCCGC CGCAGGCGAA
GATATCGAAG CGGGCCAAGG AGACGATCCA GGAGTGCGCG ACGGAGTTCA TCAGCTTCGT CACCGGCGAG GCGTCGGAGC
GGTGCCGGCG GGAGCGGCGG AAGACGGTGA ACGGCGACGA CGTCTGCCAC GCCATGAGGA GCCTCGGCCT CGACCACTAC
GCCGACGCCA TGCACAGGTA CCTGCAGAGG TACCGCGAGG GCGAGGAGCT CGCCGCGTCG CTCAACAGCA GCAGCAGCGC
CGCCGCCGCC GCCGCCGCCG CCGGCAGCAG GGGCGGTGGC GCCATACAGA TCGACGTGAG AGCTGAGCTC TCCATCTTCA
GATCAGGCAA CAACCAAGGT CGTCCAAACA ATTAA

Locus: Os01g0935100

Loading...

Locus: Os01g0935100

Loading...