Os01t0935200-01

Locus

Os01g0935200

Description

Histone-fold domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

HAP3G

CGSNL Gene Name

HAP3G SUBUNIT OF CCAAT-BOX BINDING COMPLEX

Oryzabase Gene Symbol Synonym(s)

OsHAP3G, NF-YB, CBF-A, OsNF-YB6, NF-YB6, NFYB6

Oryzabase Gene Name Synonym(s)

NUCLEAR FACTOR-Y subunit B6, NUCLEAR FACTOR-Y subunit NF-YB6, NF-YB subunit 6, NF-YB family 6

Transcript Evidence

AK242118 (DDBJ, Best hit)

Protein Evidence

NP_182302.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Cellular Component: intracellular (GO:0005622)

Cellular Component: nucleus (GO:0005634)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: sequence-specific DNA binding (GO:0043565)

Functional domain (InterPro)

Transcription factor, NFYB/HAP3, conserved site (IPR003956)

Transcription factor, CBFA/NFYB, DNA topoisomerase (IPR003957)

Transcription factor CBF/NF-Y/archaeal histone (IPR003958)

Histone-fold (IPR009072)

Full-length cDNA

J075146M01 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0935200-01)

Others

Oryzabase (8486)

KEGG (Os01t0935200-01)

Transcript

1166 bp

>Os01t0935200-01 Histone-fold domain containing protein.
GCGTGCTGCCCTCTAAATCGTCATATATACTGTAGCGCTTCCACTAGCCCAAGAACTCAC
CACCACCACCACTGAAGAGAGAGAGAGAGAGAGAGCTCGAGCTTAGCCATGGCCGACCAC
CATGGCGGCCACCACGCCGACGGGCATCGCCGGCAGCAGCAGCTGCAGGGGGAGGCGGCG
GATCAGGCGGCGGCGGAGATCATCAAGGAGCAGGACAGGTTGCTGCCAATCGCGAACGTG
GGGCGAATCATGAAGCAGATCCTCCCCCCCAACGCCAAGATCTCCAAGGAGGCCAAGGAG
ACGATGCAGGAGTGCGTCTCGGAGTTCATCAGCTTCGTCACCGGCGAGGCCTCCGACAAG
TGCCACAAGGAGAAGCGCAAGACGGTCAACGGCGACGACGTCTGCTGGGCCTTCGGCGCC
CTCGGCTTCGACGACTACGTCGACCCCATGCGCAGGTACCTCAACAAGTACCGCGAGCTC
GAGGGCGACCGCGCCGCCGCCGCCGCCACCTCCCGCTCCGGCGCCGGCGCCGCCGCGGGC
CCCGACCACCCTTCCTCCTCCTCCTCCGCCGCCGCCGCCACCGCCGGTCATTTCATGTTC
AACGCCATGGACAGGTCGACGGATAGCTCCAGGCAGTTCTAGCCACCGTTCTTTGCGTCG
TCTTCTTCTCACCCAACACCCAACCTTTCCTCCTAATCTTGAGAGGTCAGTAATTTAATT
AAGCTAAGCTACTCCATCGTCTCTAGCTACTCCATCTTACCTTACTCCTCCATATGAACA
GCTATTGCAGTGGCTAAGCTAATTAATAATTAGTAAGAGTAGCCAGTGCTTAGCTACTAG
TAGCTAGCTAGATTAGCTAATTAATCTGTGTTCATGGTGTGATATGATGGTGAGAAGCTA
GGTGGGGATGGATGTGCTGAGATTGATTGAAGGACATGGAAGATGAGGTTAGGATGAAGA
AGCTAGCAGCTAAGATGGCCCGGCGACATGATGGATATGGAGTAATTAATCGGAGTATGC
AAAATGATCGATTTTATATGAATAATTCTTGTACGTCCAATTTAATTTTTGTAGTGATTA
ATTATTTTGATCTGCACGTTATGACGATTGACATAGTTGGAGTTGGGTATTTTTGAATCT
GAGTAAATTTAATTCTAGATTTGATC

CDS

534 bp

>Os01t0935200-01 Histone-fold domain containing protein.
ATGGCCGACCACCATGGCGGCCACCACGCCGACGGGCATCGCCGGCAGCAGCAGCTGCAG
GGGGAGGCGGCGGATCAGGCGGCGGCGGAGATCATCAAGGAGCAGGACAGGTTGCTGCCA
ATCGCGAACGTGGGGCGAATCATGAAGCAGATCCTCCCCCCCAACGCCAAGATCTCCAAG
GAGGCCAAGGAGACGATGCAGGAGTGCGTCTCGGAGTTCATCAGCTTCGTCACCGGCGAG
GCCTCCGACAAGTGCCACAAGGAGAAGCGCAAGACGGTCAACGGCGACGACGTCTGCTGG
GCCTTCGGCGCCCTCGGCTTCGACGACTACGTCGACCCCATGCGCAGGTACCTCAACAAG
TACCGCGAGCTCGAGGGCGACCGCGCCGCCGCCGCCGCCACCTCCCGCTCCGGCGCCGGC
GCCGCCGCGGGCCCCGACCACCCTTCCTCCTCCTCCTCCGCCGCCGCCGCCACCGCCGGT
CATTTCATGTTCAACGCCATGGACAGGTCGACGGATAGCTCCAGGCAGTTCTAG

Protein

178 aa

>Os01t0935200-01 Histone-fold domain containing protein.
MADHHGGHHADGHRRQQQLQGEAADQAAAEIIKEQDRLLPIANVGRIMKQILPPNAKISK
EAKETMQECVSEFISFVTGEASDKCHKEKRKTVNGDDVCWAFGALGFDDYVDPMRRYLNK
YRELEGDRAAAAATSRSGAGAAAGPDHPSSSSSAAAATAGHFMFNAMDRSTDSSRQF*

5'UTR

chr01:41029918..41030025 (- strand) : 108 bp

CDS

chr01:41029384..41029917 (- strand) : 534 bp

3'UTR

chr01:41028860..41029383 (- strand) : 524 bp

FASTA

>Os01t0935200-01 class=Sequence position=chr01:41028860..41030025 (- strand)
GCGTGCTGCC CTCTAAATCG TCATATATAC TGTAGCGCTT CCACTAGCCC AAGAACTCAC CACCACCACC ACTGAAGAGA
GAGAGAGAGA GAGAGCTCGA GCTTAGCCAT GGCCGACCAC CATGGCGGCC ACCACGCCGA CGGGCATCGC CGGCAGCAGC
AGCTGCAGGG GGAGGCGGCG GATCAGGCGG CGGCGGAGAT CATCAAGGAG CAGGACAGGT TGCTGCCAAT CGCGAACGTG
GGGCGAATCA TGAAGCAGAT CCTCCCCCCC AACGCCAAGA TCTCCAAGGA GGCCAAGGAG ACGATGCAGG AGTGCGTCTC
GGAGTTCATC AGCTTCGTCA CCGGCGAGGC CTCCGACAAG TGCCACAAGG AGAAGCGCAA GACGGTCAAC GGCGACGACG
TCTGCTGGGC CTTCGGCGCC CTCGGCTTCG ACGACTACGT CGACCCCATG CGCAGGTACC TCAACAAGTA CCGCGAGCTC
GAGGGCGACC GCGCCGCCGC CGCCGCCACC TCCCGCTCCG GCGCCGGCGC CGCCGCGGGC CCCGACCACC CTTCCTCCTC
CTCCTCCGCC GCCGCCGCCA CCGCCGGTCA TTTCATGTTC AACGCCATGG ACAGGTCGAC GGATAGCTCC AGGCAGTTCT
AGCCACCGTT CTTTGCGTCG TCTTCTTCTC ACCCAACACC CAACCTTTCC TCCTAATCTT GAGAGGTCAG TAATTTAATT
AAGCTAAGCT ACTCCATCGT CTCTAGCTAC TCCATCTTAC CTTACTCCTC CATATGAACA GCTATTGCAG TGGCTAAGCT
AATTAATAAT TAGTAAGAGT AGCCAGTGCT TAGCTACTAG TAGCTAGCTA GATTAGCTAA TTAATCTGTG TTCATGGTGT
GATATGATGG TGAGAAGCTA GGTGGGGATG GATGTGCTGA GATTGATTGA AGGACATGGA AGATGAGGTT AGGATGAAGA
AGCTAGCAGC TAAGATGGCC CGGCGACATG ATGGATATGG AGTAATTAAT CGGAGTATGC AAAATGATCG ATTTTATATG
AATAATTCTT GTACGTCCAA TTTAATTTTT GTAGTGATTA ATTATTTTGA TCTGCACGTT ATGACGATTG ACATAGTTGG
AGTTGGGTAT TTTTGAATCT GAGTAAATTT AATTCTAGAT TTGATC