Os01t0948100-02

Locus

Os01g0948100

Description

Splicing variant of OsMUS81, Recombinational repair protein, DNA damage response

RAP-DB Gene Symbol Synonym(s)

OsMus81, OsMus81beta, OsMus81β

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsMUS81, OsMUS81alpha, OsMUS81beta, ERCC4

Oryzabase Gene Name Synonym(s)

Transcript Evidence

Inferred from literature

Protein Evidence

Q8GT06-2

Literature

PMID: 17327258

Note

Manual Curation

April 6, 2021

Gene Ontology (GO)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: nuclease activity (GO:0004518)

Functional domain (InterPro)

Winged helix-like DNA-binding domain superfamily (IPR036388)

Restriction endonuclease type II-like (IPR011335)

ERCC4 domain (IPR006166)

Others

Oryzabase (11613)

Transcript

2359 bp

>Os01t0948100-02 Splicing variant of OsMUS81, Recombinational repair protein, DNA damage response
AAACTCCTCCGAAACCTCCCACAAATGGCGGGCTCTTCCTCCCCAACCTGAAACCCCAAA
CCCTAACCCCCCCAATCCGGCGACCCCCCTCCACCGCAGCGGCCTCTCCAGCCCCTCGCC
GATGGCGCCGGAGGCGAGGCAACTCAAGGTGCACCTCCGGGAGAACGAGGCGGTCGCGCA
ATGCGTCCTGGAGAAGTGGCGCTCGATGGAGGAGAAGCCGGGCGGCCTCAAGGAGAACCT
GGCTCACACGCTCTACAAATCCTACCGCAACGTCTGCGCCGCCAAGGAGCCCATCCGATC
CCTCAAGGACCTGTATCAGATCAAGGGCGTTGGGAAATGGGTCATAAGGCAACTGAAAGG
ATCCTTTCCAGAGTCTAGTCCAGATTTATCTCCCCCGGAAAGTAATGCAGCAGGAGAAAA
GGGGAAGAAAGCAGGAGGGTCAAAGCGTTATGTGCCACAGAAGAATTCTGCTGCTTACGC
GATACTGATCACGCTCCATAGGGAAACAATCAATGGGAAGAGTCATATGAAGAAGCAAGA
GCTTATTGACGCCACTGAAGCAAGTGGCCTGTCACGAAGTGCAATTGGTCCAGACAAAAG
TAAAGCAAAACCAGGGGCTTTTGCAAGTTCTCAGAAGGACTGGTACACTGGATGGAGCTG
CATGAAAACATTGACATCTAAAGGACTGGTTGCAAAGTCCGGTAACCCTGCAAAGTATAT
GATAACTGAAGAAGGGAAATCGACTGCTCTTGAATGTCTCTCAAGGTCTGGGTTAGATGA
TCATGCAGCACCTTTGGTGATAAACAGTGCTCCCGACACATCTAATGCAAGTCATAAGTT
GAATAATATTTGCATGACTTCTTTTGTTGAGACATCATCCGGACCTTCTAGGGCAATTGG
TAGACCCAAAACATCTATTGCCAACCCTGCCACTAAGACATCACCAGAAGTGACATATTT
GACAAGTCAAGAATCACTCAATTACAACTCTGATGTTAGAACTGCTGAGAACTGTGCTGA
AGAAATCATTCTTAGTGACTCAGATTCTGAAGAATTATATACAGAGAACTATCCTCTAAT
AGGTTCTGAAGAATTTACTGAGAGGGTTGCCCCTCCAATATTGAATGCAAGCAACTCTGG
CAAGACTACTACAAATTACAGATTCTCAGACTGTTCAGCTTCTATTTCTCCTCGTTCGTC
TGAAGGAACATTTGAGATGCAGTCTTCTAGTACAATGGGTATTGCTGAATTCAATATGCT
GGACAATGATACTGTATGTATGGACAATTCTATACTAGCCATGCCACCTCGGCGATCCAG
TAAAAATTTTCTTGAAGATTATGAAGTTGTGTTGATATTGGATGATCGTGAAAATTTTGG
GGGTCGTTCAAGAAAAACTGTTGATAACATACATTCACAATTTCGTGTACCTGTAGAGAT
AAAGCATTTGCCTGTTGGGGATGGTATTTGGATTGCTCGTGATAGAAAGCTTCACACAGA
GTATGTTCTTGATTTCATTGTTGAAAGGAAGAATGTTGCAGATTTGTGTAGTTCAATCAC
AGACAACCGATACAAAGATCAGAAGTTAAGGCTCAAGAAATGTGGCCTAAGGAAGCTGAT
ATATCTGGTTGAAGGTGATCCAAACCCTCTTGATACATCAGAAAGGATCAAAACTGCCTG
CTTCACCACTGAAATTCTTGAAGGATTTGATGTCCAGAGAACCCCTGGGTATGCTGAGAC
TTTTGCCTGACCTATGATGAGTTTACGAAGAAGTGTGATGACCTTAAGAAGATAACTGTG
AGTGATGTATTCGCCCTTCAACTTATGCAGGTGCCACAAGTGACAGAAGAAGCTGCACTT
GCTGTGATAGGGCTCTATCCAACTCTTTTCTCACTTGCTAAGGCGTACTCTATGCTTGAT
GGTGATACCCATGCCCAAGAGAAGATGTTGAAGAACAAGAGCACGCTGATAAATGCAGGG
GCTAGCAGAAACATATTCAAGCTTGTCTGGGCTGAAGGATAAATTCTTCAGTTTATTTTC
CGATTAACTGGTTTAACCATTTTTTTGGTCATCTTCTTGGTGACTCTGATGGATCCACCA
GTGAAGCTCCCCAATTCTCAGTTCTCACTGCAACTCTTTCATGTCCTGAAGGCAAACGGG
GTCCTTTTTTGTGTGCCAAGGTGCCATGGAACACAACTAACCACCTACATAGGGACTTTG
CAAGTTAGCTTATCCGCGTAGGTTCACCCCCATCTAGGTAGACTAATTATCTTTTGTAGA
CTCCAGGTTGTACAAAATGGAATTATCATGGAACGGGGCCGTTTAGCGTTTCACATCTGT
TTACTCGGTTGCTTGGATT

CDS

1629 bp

>Os01t0948100-02 Splicing variant of OsMUS81, Recombinational repair protein, DNA damage response
ATGGCGCCGGAGGCGAGGCAACTCAAGGTGCACCTCCGGGAGAACGAGGCGGTCGCGCAA
TGCGTCCTGGAGAAGTGGCGCTCGATGGAGGAGAAGCCGGGCGGCCTCAAGGAGAACCTG
GCTCACACGCTCTACAAATCCTACCGCAACGTCTGCGCCGCCAAGGAGCCCATCCGATCC
CTCAAGGACCTGTATCAGATCAAGGGCGTTGGGAAATGGGTCATAAGGCAACTGAAAGGA
TCCTTTCCAGAGTCTAGTCCAGATTTATCTCCCCCGGAAAGTAATGCAGCAGGAGAAAAG
GGGAAGAAAGCAGGAGGGTCAAAGCGTTATGTGCCACAGAAGAATTCTGCTGCTTACGCG
ATACTGATCACGCTCCATAGGGAAACAATCAATGGGAAGAGTCATATGAAGAAGCAAGAG
CTTATTGACGCCACTGAAGCAAGTGGCCTGTCACGAAGTGCAATTGGTCCAGACAAAAGT
AAAGCAAAACCAGGGGCTTTTGCAAGTTCTCAGAAGGACTGGTACACTGGATGGAGCTGC
ATGAAAACATTGACATCTAAAGGACTGGTTGCAAAGTCCGGTAACCCTGCAAAGTATATG
ATAACTGAAGAAGGGAAATCGACTGCTCTTGAATGTCTCTCAAGGTCTGGGTTAGATGAT
CATGCAGCACCTTTGGTGATAAACAGTGCTCCCGACACATCTAATGCAAGTCATAAGTTG
AATAATATTTGCATGACTTCTTTTGTTGAGACATCATCCGGACCTTCTAGGGCAATTGGT
AGACCCAAAACATCTATTGCCAACCCTGCCACTAAGACATCACCAGAAGTGACATATTTG
ACAAGTCAAGAATCACTCAATTACAACTCTGATGTTAGAACTGCTGAGAACTGTGCTGAA
GAAATCATTCTTAGTGACTCAGATTCTGAAGAATTATATACAGAGAACTATCCTCTAATA
GGTTCTGAAGAATTTACTGAGAGGGTTGCCCCTCCAATATTGAATGCAAGCAACTCTGGC
AAGACTACTACAAATTACAGATTCTCAGACTGTTCAGCTTCTATTTCTCCTCGTTCGTCT
GAAGGAACATTTGAGATGCAGTCTTCTAGTACAATGGGTATTGCTGAATTCAATATGCTG
GACAATGATACTGTATGTATGGACAATTCTATACTAGCCATGCCACCTCGGCGATCCAGT
AAAAATTTTCTTGAAGATTATGAAGTTGTGTTGATATTGGATGATCGTGAAAATTTTGGG
GGTCGTTCAAGAAAAACTGTTGATAACATACATTCACAATTTCGTGTACCTGTAGAGATA
AAGCATTTGCCTGTTGGGGATGGTATTTGGATTGCTCGTGATAGAAAGCTTCACACAGAG
TATGTTCTTGATTTCATTGTTGAAAGGAAGAATGTTGCAGATTTGTGTAGTTCAATCACA
GACAACCGATACAAAGATCAGAAGTTAAGGCTCAAGAAATGTGGCCTAAGGAAGCTGATA
TATCTGGTTGAAGGTGATCCAAACCCTCTTGATACATCAGAAAGGATCAAAACTGCCTGC
TTCACCACTGAAATTCTTGAAGGATTTGATGTCCAGAGAACCCCTGGGTATGCTGAGACT
TTTGCCTGA

Protein

543 aa

>Os01t0948100-02 Splicing variant of OsMUS81, Recombinational repair protein, DNA damage response
MAPEARQLKVHLRENEAVAQCVLEKWRSMEEKPGGLKENLAHTLYKSYRNVCAAKEPIRS
LKDLYQIKGVGKWVIRQLKGSFPESSPDLSPPESNAAGEKGKKAGGSKRYVPQKNSAAYA
ILITLHRETINGKSHMKKQELIDATEASGLSRSAIGPDKSKAKPGAFASSQKDWYTGWSC
MKTLTSKGLVAKSGNPAKYMITEEGKSTALECLSRSGLDDHAAPLVINSAPDTSNASHKL
NNICMTSFVETSSGPSRAIGRPKTSIANPATKTSPEVTYLTSQESLNYNSDVRTAENCAE
EIILSDSDSEELYTENYPLIGSEEFTERVAPPILNASNSGKTTTNYRFSDCSASISPRSS
EGTFEMQSSSTMGIAEFNMLDNDTVCMDNSILAMPPRRSSKNFLEDYEVVLILDDRENFG
GRSRKTVDNIHSQFRVPVEIKHLPVGDGIWIARDRKLHTEYVLDFIVERKNVADLCSSIT
DNRYKDQKLRLKKCGLRKLIYLVEGDPNPLDTSERIKTACFTTEILEGFDVQRTPGYAET
FA*

5'UTR

chr01:41691190..41691310 (+ strand) : 121 bp

CDS

chr01:41691311..41691513 (+ strand) : 203 bp

chr01:41692027..41692124 (+ strand) : 98 bp

chr01:41692255..41692333 (+ strand) : 79 bp

chr01:41692486..41692572 (+ strand) : 87 bp

chr01:41692662..41692787 (+ strand) : 126 bp

chr01:41693890..41694181 (+ strand) : 292 bp

chr01:41694619..41694694 (+ strand) : 76 bp

chr01:41694775..41694831 (+ strand) : 57 bp

chr01:41694936..41695033 (+ strand) : 98 bp

chr01:41695164..41695306 (+ strand) : 143 bp

chr01:41696163..41696220 (+ strand) : 58 bp

chr01:41696696..41696854 (+ strand) : 159 bp

chr01:41697389..41697468 (+ strand) : 80 bp

chr01:41697619..41697682 (+ strand) : 64 bp

chr01:41697765..41697773 (+ strand) : 9 bp

3'UTR

chr01:41697774..41697853 (+ strand) : 80 bp

chr01:41697958..41698044 (+ strand) : 87 bp

chr01:41698248..41698689 (+ strand) : 442 bp

FASTA

>Os01t0948100-02 class=Sequence position=chr01:41691190..41698689 (+ strand)
AAACTCCTCC GAAACCTCCC ACAAATGGCG GGCTCTTCCT CCCCAACCTG AAACCCCAAA CCCTAACCCC CCCAATCCGG
CGACCCCCCT CCACCGCAGC GGCCTCTCCA GCCCCTCGCC GATGGCGCCG GAGGCGAGGC AACTCAAGGT GCACCTCCGG
GAGAACGAGG CGGTCGCGCA ATGCGTCCTG GAGAAGTGGC GCTCGATGGA GGAGAAGCCG GGCGGCCTCA AGGAGAACCT
GGCTCACACG CTCTACAAAT CCTACCGCAA CGTCTGCGCC GCCAAGGAGC CCATCCGATC CCTCAAGGAC CTGTATCAGA
TCAAGTAATA ACATGTTTCC CGTGCCTATC CCTTGTTCTA TTATTTTTCT CGGTTGCGGG GGCTGAAGGT TGCAGTGCGG
CTAGGGTTTG ATTGATTTTG GTTTGGGGGT TTTCGATTGG GCGGTTTTAC CGGAATGGTG AACTGTTGCG TGTCTAAATT
CGTCAAGATT TCAATGCGGG GACAGGGTTA TATCGTGAGC TGTAAAATCA TAATGTTCGC ATATGTTGAT CACCTATATA
TGGTAAAAAT TTGACTCAAT GCGTGTCGTC AAACCAATTT TAGTTGCTTT GAAGTAGATA AATAAGCAAG TGCTGTAACT
GTAACTGTGG CTTTAGTGTG GATTCATGTA GGAGTTTACA CTTCGGTTTT TGTTTCATAA GTTGGATTTA GAGAACAAAT
ATCTCGAACT TCACACTACT ATACATGTTT TTCTTGGTTA GTATAATCAA GCAGCATATA ATGTACCACT AATTCTCAAA
AGTATTACTG TGTTTCCTGT TCTATCACTG TTGTCAGGGG CGTTGGGAAA TGGGTCATAA GGCAACTGAA AGGATCCTTT
CCAGAGTCTA GTCCAGATTT ATCTCCCCCG GAAAGTAATG CAGCAGGAGA AAAGGGTAAC TGTTTTTATG ATTGATTGCA
TGCCTACCGA ACATCTCTTT TAGGGTACCC TTATCCTTTC TTGTGGGAAG GGTTTTTTAA GTTAATCTGC TGTGGTGAGA
ATGAAGATCA CTATTATTTC TATAGGGAAG AAAGCAGGAG GGTCAAAGCG TTATGTGCCA CAGAAGAATT CTGCTGCTTA
CGCGATACTG ATCACGCTCC ATAGGTATGC TTTGCTTGGG GATATATTTT TCATTATTTT TGCTGTTCAT CAAATGAAAG
TGTTTTCTAT CTCTTGGCAA ACAATGATAT ATAACCATAG GAATTAGAAC AGGTTCCTAC TTGTAACCAG ACAGTAACAG
TTGATTTTCC TTCTAGGGAA ACAATCAATG GGAAGAGTCA TATGAAGAAG CAAGAGCTTA TTGACGCCAC TGAAGCAAGT
GGCCTGTCAC GAAGTGCAAT TGGGTACAGT TTTCACAGTA TACTCGCAAT GTTGCTCATT CCTGCTGCTA TTTTCAGTGC
ATTACTAAGT AGGTAATTTG CATTATGAAC AGTCCAGACA AAAGTAAAGC AAAACCAGGG GCTTTTGCAA GTTCTCAGAA
GGACTGGTAC ACTGGATGGA GCTGCATGAA AACATTGACA TCTAAAGGAC TGGTTGCAAA GTCCGGTAAC CCTGCAAAGT
AATTTCATCA AACTTATCTT CCATGTCTAT GTTAACTTTT CCGCTCTGTT ACTTTAGATG AAAAATGTTT GGTTCCTACA
GTTGCAAAAA GGTTGACTGT TGTCAGTGGC AGTGCCACAT TCTTGAGTAT GGAATCTATA CACCCACTCA CAGTTATTTC
TTTTGTGAGA AAGCTCCTAC CTATCTAAAA TTCCACACAT AATCTTAAGA TAAAAATTTT ATGTGAATCA GCACCAAAGG
TTTTTGTACG TGTATTAGAT CATATGTACT AATTCTGTCT TTACTACTAG CTTTTCTGAT ATATATATAT ATATATATAT
ATATATATAT ATATATATAT ATATATATAT ATATATATAT ATATATATTC AACAGAGCAT CACTGCTAAG GGCTAGCTAT
TAATTGTGCA TCTTTTTAAA AGAGCTTCAT TAAGTTATAA TATGGAAATC AAATGAACTG AGTCATGAAC ACTTGTATTC
ATAAACTTGG TTACTTTTAT CAAAATGTTC ATGGGGCTAT TGTTTATAGT ACTAGTGATT TGCATCATTG GTTATTTGAG
GTTTGGGATA AGTTTAGCAT CACGAGACAC AAAAGCTAGG AAATTTGACA TGATGCCACC TTAAGATCCC TGCAGATGAT
TGGCAGTTTT TTTTATGTCC ACTATCTCCA TGCACTTTAT GGAATATATT GTTTTCTGAT ATTTTGAGCT AATTTTGAAA
GGACACACTT TTAGATTTAA GGATGCAGTT ATTCTGTGGC ATAGCAACAA CTCTCTATCG ATGAATAGAG GCAGAGTGGG
AGACATGGCC AATTGTGAGC TTCTTTTGAC CTGTTAGTCT ACAATGTGAA GCAACATGTA CCTACTGATC TTCCACTTGG
GATCATGATA CAGAGACCTA TCATTTGTTT GTCGCATAAA CTGTAACCCA CGTCTTGATC TCTAGTATTA CTTTAATCCA
TTTGTTTTCA TTTGTGTGAT GGGAGAACTG AGTCTATTAA GTTTACATGC ATGCATCTTG TTGGGACTAT ATTATTAAGC
AATATGTACT TTTTTGAGGT GCTAAGCATA ACTAGGGGCT TAACAAATGA ATTTCTGTAG GTATATGATA ACTGAAGAAG
GGAAATCGAC TGCTCTTGAA TGTCTCTCAA GGTCTGGGTT AGATGATCAT GCAGCACCTT TGGTGATAAA CAGTGCTCCC
GACACATCTA ATGCAAGTCA TAAGTTGAAT AATATTTGCA TGACTTCTTT TGTTGAGACA TCATCCGGAC CTTCTAGGGC
AATTGGTAGA CCCAAAACAT CTATTGCCAA CCCTGCCACT AAGACATCAC CAGAAGTGAC ATATTTGACA AGTCAAGAAT
CACTCAATTA CAACTCTGAT GTTAGAACTG CTGTAAGTTC TACCTTTACT AACATTGCTT TAGAAGCTAT TTTTCCCAAG
CTAAGAATGT GACAAAAGAT CCATTGGTCT GGTTCTATTG TATTATATAG TTTTTCTTCT GATCAAGTTC TTCAATTTAA
TGATCACAAT ATTCAATCTT AGCTTCTGGT TCAGCTGTTT CAGCATAAGC AGAACTGCCA TTATTTTTGT ATCTCAATAA
AGCAAAGCCT TTTTGTAGCT TTGCGATGTT GTTGCTGTCT AATAGTGCTA CAATTTGGTG AAGTCCAATC AGGCACTTTT
CCTTTTTAGG TTTTACGTGG TTTGGGTTGT AATTAGTGTA CATAATTCTG AATTACAGGC TAGGCTTTCG GCCATAGTTC
CATACTTTTC TGTCATACTA GAATTTTAGA TGCTGTAGTA TAACTCATAG ATTCTCTTAT CTTTTTTAGG AGAACTGTGC
TGAAGAAATC ATTCTTAGTG ACTCAGATTC TGAAGAATTA TATACAGAGA ACTATCCTCT AATAGGTAAA ATTGTTATTT
CGAGCTCACA AACAATTTGT TATATTCCTT CTGCGCTAAA ATAAATTTTG GTTTCCTAAG TGCAGGTTCT GAAGAATTTA
CTGAGAGGGT TGCCCCTCCA ATATTGAATG CAAGCAACTC TGGTTGTCTA TCAATCTTAT GTTTTCTATT AGAATAATAT
TGCATCCAAT AAAAGTATTA TTTTTACTGG CCTTTTCAAT TAATCCCAAT AACCTTTTTT TTCCAGGCAA GACTACTACA
AATTACAGAT TCTCAGACTG TTCAGCTTCT ATTTCTCCTC GTTCGTCTGA AGGAACATTT GAGATGCAGT CTTCTAGTAC
AATGGTAACC TGACCTTTTG TGGTTAAATC CCTAATCCCT AATCCCTATT CTGTAACTTA TTCCCTTTTG AAGTTGAAGA
TGCTGATTAC TCAAAGAAAT GACGGTACTG CTATTACATC TTTTCAACTA CCAGGGTATT GCTGAATTCA ATATGCTGGA
CAATGATACT GTATGTATGG ACAATTCTAT ACTAGCCATG CCACCTCGGC GATCCAGTAA AAATTTTCTT GAAGATTATG
AAGTTGTGTT GATATTGGAT GATCGTGAAA ATTTTGGGTT TGTATGATCG TACCATACTC TTACATCTTA CAAAATTTGT
ATCTATGGTT GTATCATGGG TATTAGGTAG GGGTCTGAGG CCCACGATGG TACTGTTCAC TCCTACCTTA TCTTAATCTG
TTAGCCAACA TATAAGCACT CAAAATTTAC ATAGCTTGTT TGAAAAATCA ATCTATTCAT TATGGACAGT TACATTACAC
AATGTTTCAA GGTTATCTGG ATAAGAGGAT GCTAGTTTCA AGGATTTGAT TAATGTACTG ATTATTTGCA TTCTATCCTT
TCCATTGATT TGCAAATATG AGAGAAATTT ATTTTACTCT TTGCACACTG TTCCGTTAAA GTAAGACACA TGATGATTTT
TCAAATACCA TTCTTTTTCC CTTTTGGAGC CCATTGCAAT GCTTAACTAA CTTCATTTTC CTGAATCTTA AAACACTTTG
AACCCGTATT GTTTTCAGTT AATTTTACCT TTAATGTTGA TGTTTGGTGC ATCTAACTGT CTATCCTTAA ACTTTTGGGT
CTCATGTTAA GGTCTAACTA GTAACCTCTC AACTCAAACA GCTGAAACGA TTGGAACATG TGCTTTTATG TTCTAGTATT
AGGTTTATGA GAACTATTTG TCATGTTCCT TTTCCAATAT TGCTAAGACA GCTCGATATT TTTCTATGAA ATTTTTCATT
ACTGAAATTT TAAGTACCAG ATACACATGG GGCTGCATTT TTGTTTCAAA TATTTTGCTA CTACCCATTT CCCCCCTGCA
ATTACATGTT TTATATTAAC TTCATTCATT GGCTTTATTT CGAACAACTG TGTATCTGTT CGTTCTCAAA ACTGTTACCT
TTTCTTTTGG CAGGGGTCGT TCAAGAAAAA CTGTTGATAA CATACATTCA CAATTTCGTG TACCTGTAGA GGTTAGTTAA
GTTTGAATTT TTAGTCTTTC TAATCTCTCC TTACTTCCTC TGTTTCCCAT TATCCTTGCA CATCTCCTCA CTCCTCGGAC
CACCCAAACT TGCTTCACAA ATTCAATACC ATTTCATCAA CATGATTATA ATTAAATATC CTGGCAATAA CAAGAAATCT
TCTTTAAACA ATATAAAGCA GGCACTAATT TCTTCTGTTT GCTTACCTGA TGCACAAGTT CAAATATATA ATTTAGATGA
TTTGTATGCT AGTTTTGGTG TGCTGGTAAA ATATTGATCA AAAGAGCAGG GGAAACACCT GCGCTGAATA TATAAGCTTG
CCCTAACTTC TGTGGGACTA AAGCTGCAGC TGTTGCTGTA GGCAATAAAT GAAGTGTCAC AGATTTTGTT CATAAATTGA
GTTGTTCATT TAGCGTGTGC CAGTGAAAGT GATTTTTGAT CCTTCTATTT GAACCATGTC TTTCAGATAA AGCATTTGCC
TGTTGGGGAT GGTATTTGGA TTGCTCGTGA TAGAAAGCTT CACACAGAGT ATGTTCTTGA TTTCATTGTT GAAAGGAAGA
ATGTTGCAGA TTTGTGTAGT TCAATCACAG ACAACCGATA CAAAGATCAG AAGTTAAGGC TCAAGGTACC ATCTGCGCTA
TCATCGCCTT CGCTTTAATA TTGAACTTTA ATGTTAATTC CCCTTGTTTT TTATATTTTC AGTTTTGTTA CTTGTACGAA
ATTCAGTTTG TTTCTTATTA TAATCCTATC AGCAGGTGTG GCTACTGAAA ACATTTATTT GTTCATGTGC CACTGACATT
TGTAGCAATT AGGTTGATGG CAAACTCGTG AGCATGTTTG GCTGCATAAT CATGGAAGCA AATGTGACAC TTAATCATAG
ATCCAGTGTA ACTTAATTTG ATGTTATGGT ACAAATACCG TTGAACTTTT TTTTTCCTTA GGTCTTTCAT AGTTATATTT
GTAAAGTTGA TATTGATTTG TGTTGAGAAC TACTGAATTT TATGTGGAAT GTTCTAGTTT TCCCTGATGC TAGGACTCGA
GCCTGTAGAT TTTGAACCTC CTCTCAGGCA TATTGTTTAT CTTTTCCATA TATATGCACC ATATTTTGTT TATTGTTAGC
AGCAATATGT TGTGATTCTT TGGTGCACCT TGTTTGTAGA AATGTGGCCT AAGGAAGCTG ATATATCTGG TTGAAGGTGA
TCCAAACCCT CTTGATACAT CAGAAAGGAT CAAAACTGCG TATGTACTCT GCAGCAGCTT TTTCTTGTTG ATTTCTCTTC
TTTTACCCTC CCTTAAAAGT AGTTTGTATT GTATAGATTT GTCAGTCAAT GAATTGGATT TTTGGCTGCA TGACATATGA
CCTTGTAACC GCTGGCCTTA TATATGCAGC TGCTTCACCA CTGAAATTCT TGAAGGATTT GATGTCCAGA GAACCCCTGG
GTATGCTGAG ACTGTAAGGA CATATGGCAA CCTTACTCAT TCAATAACCG AATACTACAG CACACACTTT TCTACTGGTG
CTAATACTTC TCAAGTTTGC CTGACCTATG ATGAGTTTAC GAAGAAGTGT GATGACCTTA AGAAGATAAC TGTGAGTGAT
GTATTCGCCC TTCAACTTAT GCAGGTAATT GGGCAATAAA AACAATCTTC ACCAAAGTCA GACATCTATT CATTTCATGT
TGTAGTTGGA GGCAAGAATT TTCCTAATTA ATTATGAATG TGATGCAGGT GCCACAAGTG ACAGAAGAAG CTGCACTTGC
TGTGATAGGG CTCTATCCAA CTCTTTTCTC ACTTGCTAAG GCGTACTCTA TGCTTGTCAG TTCCCTTCTC CTTTTAACTT
TTACAATGTT CATTAGACGC ACCATTTTAA TGTTCTTTCC ATTTATAACT CCTGTTTATA CTTGTAAACC AGAACAGCGT
AGTGCATTCC ATATCTCTTG CTGCTCTAGT ACTATTTATC TCACACAATA TGCTTTATTC TTTTCGTGAA TTAAACCTTG
TTTTTGTGAT GTTTTTAGGA TGGTGATACC CATGCCCAAG AGAAGATGTT GAAGAACAAG AGCACGCTGA TAAATGCAGG
GGCTAGCAGA AACATATTCA AGCTTGTCTG GGCTGAAGGA TAAATTCTTC AGTTTATTTT CCGATTAACT GGTTTAACCA
TTTTTTTGGT CATCTTCTTG GTGACTCTGA TGGATCCACC AGTGAAGCTC CCCAATTCTC AGTTCTCACT GCAACTCTTT
CATGTCCTGA AGGCAAACGG GGTCCTTTTT TGTGTGCCAA GGTGCCATGG AACACAACTA ACCACCTACA TAGGGACTTT
GCAAGTTAGC TTATCCGCGT AGGTTCACCC CCATCTAGGT AGACTAATTA TCTTTTGTAG ACTCCAGGTT GTACAAAATG
GAATTATCAT GGAACGGGGC CGTTTAGCGT TTCACATCTG TTTACTCGGT TGCTTGGATT 

Locus: Os01g0948100

Loading...

Locus: Os01g0948100

Loading...