Os01t0948400-01

Locus

Os01g0948400

Description

Similar to Pyrroline-5-carboxylate reductase (EC 1.5.1.2) (P5CR) (P5C reductase).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

P5CR

CGSNL Gene Name

PYRROLINE-5-CARBOXYLATE REDUCTASE

Oryzabase Gene Symbol Synonym(s)

OsP5CR

Oryzabase Gene Name Synonym(s)

delta-pyrroline-5-carboxylate reductase, pyrroline-5-carboxylate reductase

Transcript Evidence

AK070184 (DDBJ, Best hit)

Protein Evidence

C5XHU2 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: proline biosynthetic process (GO:0006561)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: nucleotide binding (GO:0000166)

Molecular Function: pyrroline-5-carboxylate reductase activity (GO:0004735)

Molecular Function: oxidoreductase activity (GO:0016491)

Molecular Function: oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor (GO:0016616)

Functional domain (InterPro)

Pyrroline-5-carboxylate reductase (IPR000304)

NADP oxidoreductase, coenzyme F420-dependent (IPR004455)

6-phosphogluconate dehydrogenase, C-terminal-like (IPR008927)

NAD(P)-binding domain (IPR016040)

Full-length cDNA

J023044E03 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0948400-01)

RiceXPro (AK070184)

Others

Oryzabase (21738)

KEGG (Os01t0948400-01 (EC:1.5.1.2))

Transcript

1206 bp

>Os01t0948400-01 Similar to Pyrroline-5-carboxylate reductase (EC 1.5.1.2) (P5CR) (P5C reductase).
GGCCCCCGGCCAAGTGACGAGCAAAACCCACCCAAAAAAAAAATACAGCGGAGACGCGCG
ACGGCGGCGCAGTTCCCCGCTCCGCCGCTCCGTGCTCCGACCTCCGGCGACCCCGGGCAC
CGGCGAGTGGCCCCGACGGCCATCCAGCTTGTCAGCATTATTAGGCCTCGAAACCTACCT
TCCACATCCACGCCATTCTTCTCCGCCTCCTCCTCCTCCTCCTCCTCCTCGGgttcatcg
gcccgggtaacctcgcggagagcatcgcccgcggcgtggcggcgtcgggcgtcctcccgg
ccaccgcgatccgcaccgcgccacaccgccgccccgagcgcgccgaggccttctcatcca
tcggagctcacatcttggagaccaacgcgcagGTAGTTGATGACAGTGACGTGATCGTCA
TCTCTGTGAAGCCGCAGATCGTAAGGCAGGTACTGGTTGAGCTAAAACCCTTGCTGTCAG
AAGAAAAGCTTCTGGTGTCCATTGCTGCTGGCATCAAGATGGAAGATCTGCAGGGTTGGT
CTGGTCATCGAAGATTTATTAGAGTAATGCCAAACACCCCTTCAGCTGTTGGACAAGCAG
CATCAGTGATGTGTTTGGGGGAGATGGCTACTGAGAATGATGAAAACCGTGTAAGAAGTT
TATTCAGTGCCATTGGAAAAGTTTGGACAGCTGAAGAAAAATATTTTGATGCTGTAACTG
GGCTAAGTGGTAGTGGCCCGGCTTATATTTTCTTAGCAATAGAGGCCATGGCTGATGGTG
GAGTTGCTGCTGGTCTTCCTCGGGATCTTGCACTTGGTCTTGCATCTCAGACAGTTCTTG
GTGCTGCAACCATGGTAAACAAGACTGGAAAACATCCGGGTCAGCTGAAGGATATGGTCA
CTTCCCCGGCAGGAACCACCATAACTGGGATACAAGAGCTTGAGAAGGGTGCATTCCGTG
GGACGCTGATAAATGCCGTTGTTGCTGCTACAAAGCGTTGCCGTGAACTTTCTCAGAGTT
AATCCTCTTGTTAGTTGTTAGTCCATTGGATGTGCGACTCTGCGCACGATTTCCCCTAGG
GAAGAGGATGTGCGAATATTGATATTTAAACCTGATGAGGCTATCAGCAAATTTTGCTTG
TAGTTTTATCCGAATAATTTGCTGCACTTTAGTGGCACGAAATCTGGATGATGTTAGATT
GATACT

CDS

858 bp

>Os01t0948400-01 Similar to Pyrroline-5-carboxylate reductase (EC 1.5.1.2) (P5CR) (P5C reductase).
GCCTCGAAACCTACCTTCCACATCCACGCCATTCTTCTCCGCCTCCTCCTCCTCCTCCTC
CTCCTCGGgttcatcggcccgggtaacctcgcggagagcatcgcccgcggcgtggcggcg
tcgggcgtcctcccggccaccgcgatccgcaccgcgccacaccgccgccccgagcgcgcc
gaggccttctcatccatcggagctcacatcttggagaccaacgcgcagGTAGTTGATGAC
AGTGACGTGATCGTCATCTCTGTGAAGCCGCAGATCGTAAGGCAGGTACTGGTTGAGCTA
AAACCCTTGCTGTCAGAAGAAAAGCTTCTGGTGTCCATTGCTGCTGGCATCAAGATGGAA
GATCTGCAGGGTTGGTCTGGTCATCGAAGATTTATTAGAGTAATGCCAAACACCCCTTCA
GCTGTTGGACAAGCAGCATCAGTGATGTGTTTGGGGGAGATGGCTACTGAGAATGATGAA
AACCGTGTAAGAAGTTTATTCAGTGCCATTGGAAAAGTTTGGACAGCTGAAGAAAAATAT
TTTGATGCTGTAACTGGGCTAAGTGGTAGTGGCCCGGCTTATATTTTCTTAGCAATAGAG
GCCATGGCTGATGGTGGAGTTGCTGCTGGTCTTCCTCGGGATCTTGCACTTGGTCTTGCA
TCTCAGACAGTTCTTGGTGCTGCAACCATGGTAAACAAGACTGGAAAACATCCGGGTCAG
CTGAAGGATATGGTCACTTCCCCGGCAGGAACCACCATAACTGGGATACAAGAGCTTGAG
AAGGGTGCATTCCGTGGGACGCTGATAAATGCCGTTGTTGCTGCTACAAAGCGTTGCCGT
GAACTTTCTCAGAGTTAA

Protein

286 aa

>Os01t0948400-01 Similar to Pyrroline-5-carboxylate reductase (EC 1.5.1.2) (P5CR) (P5C reductase).
ASKPTFHIHAILLRLLLLLLLLGFIGPGNLAESIARGVAASGVLPATAIRTAPHRRPERA
EAFSSIGAHILETNAQVVDDSDVIVISVKPQIVRQVLVELKPLLSEEKLLVSIAAGIKME
DLQGWSGHRRFIRVMPNTPSAVGQAASVMCLGEMATENDENRVRSLFSAIGKVWTAEEKY
FDAVTGLSGSGPAYIFLAIEAMADGGVAAGLPRDLALGLASQTVLGAATMVNKTGKHPGQ
LKDMVTSPAGTTITGIQELEKGAFRGTLINAVVAATKRCRELSQS*

5'UTR

chr01:41721416..41721571 (- strand) : 156 bp

chr01:41721133..41721140 (- strand) : 8 bp

CDS

chr01:41721065..41721132 (- strand) : 68 bp

chr01:41720830..41720989 (- strand) : 160 bp

chr01:41720541..41720589 (- strand) : 49 bp

chr01:41720135..41720226 (- strand) : 92 bp

chr01:41719835..41719907 (- strand) : 73 bp

chr01:41719331..41719451 (- strand) : 121 bp

chr01:41719124..41719229 (- strand) : 106 bp

chr01:41718861..41719049 (- strand) : 189 bp

3'UTR

chr01:41718677..41718860 (- strand) : 184 bp

FASTA

>Os01t0948400-01 class=Sequence position=chr01:41718677..41721571 (- strand)
GGCCCCCGGC CAAGTGACGA GCAAAACCCA CCCAAAAAAA AAATACAGCG GAGACGCGCG ACGGCGGCGC AGTTCCCCGC
TCCGCCGCTC CGTGCTCCGA CCTCCGGCGA CCCCGGGCAC CGGCGAGTGG CCCCGACGGC CATCCAGCTT GTCAGCGTCG
GTTCCTCTTC CTTCTACTCT CAAATTTTTA GTCTCTTATT ATCAACAGGA TTGACCTGTT CACTGTTCAG GGAGCCTGTT
CTTATCGCAT TATCCAGATT TTTCTTTTCA AAAAACATGA AATCATCACT GGATTTTGCT TTAATAACTT ATTATTATCA
GTTTGTTTGC GATTTGAACC AAACAAGTGT AACAAATCTT CGTATCGTTC ACCCAAAATA TCTCCTGGTT TTTCTCGTTT
CCGTTTCGAA TTAACAGAAT TTTCACTACA GATTATTAGG CCTCGAAACC TACCTTCCAC ATCCACGCCA TTCTTCTCCG
CCTCCTCCTC CTCCTCCTCC TCCTCGGATC CCTCGCAATG GCGGCGCCGC CTCAgcccgt gccggcgccc gcggccgcgt
cgccggaggt gttccggctc gggttcatcg gcccgggtaa cctcgcggag agcatcgccc gcggcgtggc ggcgtcgggc
gtcctcccgg ccaccgcgat ccgcaccgcg ccacaccgcc gccccgagcg cgccgaggcc ttctcatcca tcggagctca
catcttggag accaacgcgc aggtatcctg ggctgcttTG GATTGCCACC AATTCCCACT AATTTTGAGT ACCTTCAGTT
GTACTTGTAT GTTTGATTCA AGCCAGTACC TGTTGGAAAT CCTACCAAAA TTTGAATCCT AGCAAACTCT ACCCTACCAA
ATGTTCTTCT ATGCCATTTT TTTTCTTATG GCATGTAATT CAGTTCATTA TCCATCACAT TAGACAGCAA GTAACTCTTC
TCTTGTTATT ATCTTGTGAT AGGTAGTTGA TGACAGTGAC GTGATCGTCA TCTCTGTGAA GCCGCAGATC GGTATGTTGC
ATCTTGTCCT GTTTTCTCAT CTTTGTACAA CATCTGTTTT TTCCTATGTT TTCAGATTTC AGTTTATTGT TTTCGGAAGG
AAGCATATTT TTAAAGGCAA AATTAGGAGA ACTAGTTAGA TTTTAGTGTA CCGCTGCTAC TTCAGGTGTT TTCTGATGTT
CTGGAGATGT AAATGCTTTA GGGGAAAAAG TCAGTGATCA ATTTCACAAA TGTTCTCAGG ATATTTGCTA GTGATGTATG
GGTAACGTTT GAGACTTTGA GTAGGTTTTG CATGCTTATG AGATTACCTC TGCATCAAAT TGCAGTAAGG CAGGTACTGG
TTGAGCTAAA ACCCTTGCTG TCAGAAGAAA AGCTTCTGGT GTCCATTGCT GCTGGCATCA AGATGGAAGA TCTGCAGGTG
AATCTATATT TTTGTTTTAC TCAATATCTT AACTCATGGC TTCTGGTGTG AAATATTGCT CTATCTACAT TCCATGTAGA
AGCAGCGAAC TGTTGCACAA TGCCTAATTG TGTGGATAAC GTATGAGATA AAAACATCTT TATTCATGCC AGATCTTTTT
TCCCTCAGTT GGAAACGTTC AGTTGTTCAC AGTTTGGCCT ATTTTCTTTT GATTGTAATT CCAGGGTTGG TCTGGTCATC
GAAGATTTAT TAGAGTAATG CCAAACACCC CTTCAGCTGT TGGACAAGCA GCATCAGGTA ACATATATGA CAATCATCCA
TTAACTTTCA TATGCTTGTT TCATGTGTAC TTTGTGATAG ATTATGTGTT ATGGTTGTCG GACTGAAAAT CACATAATCT
ATTGGTAATC AACCTTTGTT GTAAAGTTAT CAATCGACTA ATATTGTGTG TCGATATCTC TTTCAGAATA TCACTTTTTT
TTAAGGAAGA TATCACCTAT TTTAGTGAAC AACACTTTTA TATAATCCTT CCAGGAGAAA AAAAGAACTA CCATTATGTT
AAGAGTTGGG TGGTAGAATT TTTTAAATGC AAATGCTCAT ACATTTAGTA ATTGAAATCG TAGTTTATCT TCTCAAAGAA
CTGAGAATTA ATCAATTGCT GATCTCGTTG TATCTGCTAG TGATGTGTTT GGGGGAGATG GCTACTGAGA ATGATGAAAA
CCGTGTAAGA AGTTTATTCA GTGCCATTGG AAAAGTTTGG ACAGCTGAAG AAAAATATTT TGATGCTGTA ACTGGGCTAA
GGTATGTGAC TAATTTTACA GATCTTTTCT TGAAAAGCTT CACTGGAAAC AATATGTTAT GATTTTGAGA ATAAACATGT
ATTCCCATCT ATTTGAATAC AGTGGTAGTG GCCCGGCTTA TATTTTCTTA GCAATAGAGG CCATGGCTGA TGGTGGAGTT
GCTGCTGGTC TTCCTCGGGA TCTTGCACTT GGTCTTGCAT CTCAGACAGT GAGTGTTCCT TCCATAAAAT ATGTTGCGAT
ATTGTTCTAT GCTCTGGTCA CATATTCTGT TGATCTATAT AGGTTCTTGG TGCTGCAACC ATGGTAAACA AGACTGGAAA
ACATCCGGGT CAGCTGAAGG ATATGGTCAC TTCCCCGGCA GGAACCACCA TAACTGGGAT ACAAGAGCTT GAGAAGGGTG
CATTCCGTGG GACGCTGATA AATGCCGTTG TTGCTGCTAC AAAGCGTTGC CGTGAACTTT CTCAGAGTTA ATCCTCTTGT
TAGTTGTTAG TCCATTGGAT GTGCGACTCT GCGCACGATT TCCCCTAGGG AAGAGGATGT GCGAATATTG ATATTTAAAC
CTGATGAGGC TATCAGCAAA TTTTGCTTGT AGTTTTATCC GAATAATTTG CTGCACTTTA GTGGCACGAA ATCTGGATGA
TGTTAGATTG ATACT

Locus: Os01g0948400

Loading...

Locus: Os01g0948400

Loading...