Os01t0948400-02

Locus

Os01g0948400

Description

Pyrroline-5-carboxylate reductase, Proline biosynthesis, Response to osmotic and salt stress

RAP-DB Gene Symbol Synonym(s)

OsP5CR

RAP-DB Gene Name Synonym(s)

delta-pyrroline-5-carboxylate reductase, pyrroline-5-carboxylate reductase

CGSNL Gene Symbol

P5CR

CGSNL Gene Name

PYRROLINE-5-CARBOXYLATE REDUCTASE

Oryzabase Gene Symbol Synonym(s)

OsP5CR

Oryzabase Gene Name Synonym(s)

delta-pyrroline-5-carboxylate reductase, pyrroline-5-carboxylate reductase

Transcript Evidence

AK067368

Protein Evidence

Q8GT01

Literature

PMID: 30303953

PMID: 23661451

Note

Manual Curation

July 22, 2020

Gene Ontology (GO)

Biological Process: proline biosynthetic process (GO:0006561)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: pyrroline-5-carboxylate reductase activity (GO:0004735)

Functional domain (InterPro)

NAD(P)-binding domain superfamily (IPR036291)

6-phosphogluconate dehydrogenase-like, C-terminal domain superfamily (IPR008927)

Pyrroline-5-carboxylate reductase (IPR000304)

Pyrroline-5-carboxylate reductase, catalytic, N-terminal (IPR028939)

Pyrroline-5-carboxylate reductase, dimerisation domain (IPR029036)

Full-length cDNA

J013104L18 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0948400-02)

RiceXPro (AK067368)

Others

Oryzabase (21738)

Transcript

1319 bp

>Os01t0948400-02 Pyrroline-5-carboxylate reductase, Proline biosynthesis, Response to osmotic and salt stress
GGCCCCCGGCCAAGTGACGAGCAAAACCCACCCAAAAAAAAAATACAGCGGAGACGCGCG
ACGGCGGCGCAGTTCCCCGCTCCGCCGCTCCGTGCTCCGACCTCCGGCGACCCCGGGCAC
CGGCGAGTGGCCCCGACGGCCATCCAGCTTGTCAGCATTATTAGGCCTCGAAACCTACCT
TCCACATCCACGCCATTCTTCTCCGCCTCCTCCTCCTCCTCCTCCTCCTCGGATCCCTCG
CAATGGCGGCGCCGCCTCAgcccgtgccggcgcccgcggccgcgtcgccggaggtgttcc
ggctcgggttcatcggcccgggtaacctcgcggagagcatcgcccgcggcgtggcggcgt
cgggcgtcctcccggccaccgcgatccgcaccgcgccacaccgccgccccgagcgcgccg
aggccttctcatccatcggagctcacatcttggagaccaacgcgcagGTAGTTGATGACA
GTGACGTGATCGTCATCTCTGTGAAGCCGCAGATCGTAAGGCAGGTACTGGTTGAGCTAA
AACCCTTGCTGTCAGAAGAAAAGCTTCTGGTGTCCATTGCTGCTGGCATCAAGATGGAAG
ATCTGCAGGGTTGGTCTGGTCATCGAAGATTTATTAGAGTAATGCCAAACACCCCTTCAG
CTGTTGGACAAGCAGCATCAGTGATGTGTTTGGGGGAGATGGCTACTGAGAATGATGAAA
ACCGTGTAAGAAGTTTATTCAGTGCCATTGGAAAAGTTTGGACAGCTGAAGAAAAATATT
TTGATGCTGTAACTGGGCTAAGTGGTAGTGGCCCGGCTTATATTTTCTTAGCAATAGAGG
CCATGGCTGATGGTGGAGTTGCTGCTGGTCTTCCTCGGGATCTTGCACTTGGTCTTGCAT
CTCAGACAGTTCTTGGTGCTGCAACCATGGTAAACAAGACTGGAAAACATCCGGGTCAGC
TGAAGGATATGGTCACTTCCCCGGCAGGAACCACCATAACTGGGATACAAGAGCTTGAGA
AGGGTGCATTCCGTGGGACGCTGATAAATGCCGTTGTTGCTGCTACAAAGCGTTGCCGTG
AACTTTCTCAGAGTTAATCCTCTTGTTAGTTGTTAGTCCATTGGATGTGCGACTCTGCGC
ACGATTTCCCCTAGGGAAGAGGATGTGCGAATATTGATATTTAAACCTGATGAGGCTATC
AGCAAATTTTGCTTGTAGTTTTATCCGAATAATTTGCTGCACTTTAGTGGCACGAAATCT
GGATGATGTTAGATTGATACTTATTCTGGCAGCAGCTGTTTTTGATCGTTTTTGTTGGG

CDS

855 bp

>Os01t0948400-02 Pyrroline-5-carboxylate reductase, Proline biosynthesis, Response to osmotic and salt stress
ATGGCGGCGCCGCCTCAgcccgtgccggcgcccgcggccgcgtcgccggaggtgttccgg
ctcgggttcatcggcccgggtaacctcgcggagagcatcgcccgcggcgtggcggcgtcg
ggcgtcctcccggccaccgcgatccgcaccgcgccacaccgccgccccgagcgcgccgag
gccttctcatccatcggagctcacatcttggagaccaacgcgcagGTAGTTGATGACAGT
GACGTGATCGTCATCTCTGTGAAGCCGCAGATCGTAAGGCAGGTACTGGTTGAGCTAAAA
CCCTTGCTGTCAGAAGAAAAGCTTCTGGTGTCCATTGCTGCTGGCATCAAGATGGAAGAT
CTGCAGGGTTGGTCTGGTCATCGAAGATTTATTAGAGTAATGCCAAACACCCCTTCAGCT
GTTGGACAAGCAGCATCAGTGATGTGTTTGGGGGAGATGGCTACTGAGAATGATGAAAAC
CGTGTAAGAAGTTTATTCAGTGCCATTGGAAAAGTTTGGACAGCTGAAGAAAAATATTTT
GATGCTGTAACTGGGCTAAGTGGTAGTGGCCCGGCTTATATTTTCTTAGCAATAGAGGCC
ATGGCTGATGGTGGAGTTGCTGCTGGTCTTCCTCGGGATCTTGCACTTGGTCTTGCATCT
CAGACAGTTCTTGGTGCTGCAACCATGGTAAACAAGACTGGAAAACATCCGGGTCAGCTG
AAGGATATGGTCACTTCCCCGGCAGGAACCACCATAACTGGGATACAAGAGCTTGAGAAG
GGTGCATTCCGTGGGACGCTGATAAATGCCGTTGTTGCTGCTACAAAGCGTTGCCGTGAA
CTTTCTCAGAGTTAA

Protein

285 aa

>Os01t0948400-02 Pyrroline-5-carboxylate reductase, Proline biosynthesis, Response to osmotic and salt stress
MAAPPQPVPAPAAASPEVFRLGFIGPGNLAESIARGVAASGVLPATAIRTAPHRRPERAE
AFSSIGAHILETNAQVVDDSDVIVISVKPQIVRQVLVELKPLLSEEKLLVSIAAGIKMED
LQGWSGHRRFIRVMPNTPSAVGQAASVMCLGEMATENDENRVRSLFSAIGKVWTAEEKYF
DAVTGLSGSGPAYIFLAIEAMADGGVAAGLPRDLALGLASQTVLGAATMVNKTGKHPGQL
KDMVTSPAGTTITGIQELEKGAFRGTLINAVVAATKRCRELSQS*

5'UTR

chr01:41721416..41721571 (- strand) : 156 bp

chr01:41721055..41721140 (- strand) : 86 bp

CDS

chr01:41720830..41721054 (- strand) : 225 bp

chr01:41720541..41720589 (- strand) : 49 bp

chr01:41720135..41720226 (- strand) : 92 bp

chr01:41719835..41719907 (- strand) : 73 bp

chr01:41719331..41719451 (- strand) : 121 bp

chr01:41719124..41719229 (- strand) : 106 bp

chr01:41718861..41719049 (- strand) : 189 bp

3'UTR

chr01:41718639..41718860 (- strand) : 222 bp

FASTA

>Os01t0948400-02 class=Sequence position=chr01:41718639..41721571 (- strand)
GGCCCCCGGC CAAGTGACGA GCAAAACCCA CCCAAAAAAA AAATACAGCG GAGACGCGCG ACGGCGGCGC AGTTCCCCGC
TCCGCCGCTC CGTGCTCCGA CCTCCGGCGA CCCCGGGCAC CGGCGAGTGG CCCCGACGGC CATCCAGCTT GTCAGCGTCG
GTTCCTCTTC CTTCTACTCT CAAATTTTTA GTCTCTTATT ATCAACAGGA TTGACCTGTT CACTGTTCAG GGAGCCTGTT
CTTATCGCAT TATCCAGATT TTTCTTTTCA AAAAACATGA AATCATCACT GGATTTTGCT TTAATAACTT ATTATTATCA
GTTTGTTTGC GATTTGAACC AAACAAGTGT AACAAATCTT CGTATCGTTC ACCCAAAATA TCTCCTGGTT TTTCTCGTTT
CCGTTTCGAA TTAACAGAAT TTTCACTACA GATTATTAGG CCTCGAAACC TACCTTCCAC ATCCACGCCA TTCTTCTCCG
CCTCCTCCTC CTCCTCCTCC TCCTCGGATC CCTCGCAATG GCGGCGCCGC CTCAgcccgt gccggcgccc gcggccgcgt
cgccggaggt gttccggctc gggttcatcg gcccgggtaa cctcgcggag agcatcgccc gcggcgtggc ggcgtcgggc
gtcctcccgg ccaccgcgat ccgcaccgcg ccacaccgcc gccccgagcg cgccgaggcc ttctcatcca tcggagctca
catcttggag accaacgcgc aggtatcctg ggctgcttTG GATTGCCACC AATTCCCACT AATTTTGAGT ACCTTCAGTT
GTACTTGTAT GTTTGATTCA AGCCAGTACC TGTTGGAAAT CCTACCAAAA TTTGAATCCT AGCAAACTCT ACCCTACCAA
ATGTTCTTCT ATGCCATTTT TTTTCTTATG GCATGTAATT CAGTTCATTA TCCATCACAT TAGACAGCAA GTAACTCTTC
TCTTGTTATT ATCTTGTGAT AGGTAGTTGA TGACAGTGAC GTGATCGTCA TCTCTGTGAA GCCGCAGATC GGTATGTTGC
ATCTTGTCCT GTTTTCTCAT CTTTGTACAA CATCTGTTTT TTCCTATGTT TTCAGATTTC AGTTTATTGT TTTCGGAAGG
AAGCATATTT TTAAAGGCAA AATTAGGAGA ACTAGTTAGA TTTTAGTGTA CCGCTGCTAC TTCAGGTGTT TTCTGATGTT
CTGGAGATGT AAATGCTTTA GGGGAAAAAG TCAGTGATCA ATTTCACAAA TGTTCTCAGG ATATTTGCTA GTGATGTATG
GGTAACGTTT GAGACTTTGA GTAGGTTTTG CATGCTTATG AGATTACCTC TGCATCAAAT TGCAGTAAGG CAGGTACTGG
TTGAGCTAAA ACCCTTGCTG TCAGAAGAAA AGCTTCTGGT GTCCATTGCT GCTGGCATCA AGATGGAAGA TCTGCAGGTG
AATCTATATT TTTGTTTTAC TCAATATCTT AACTCATGGC TTCTGGTGTG AAATATTGCT CTATCTACAT TCCATGTAGA
AGCAGCGAAC TGTTGCACAA TGCCTAATTG TGTGGATAAC GTATGAGATA AAAACATCTT TATTCATGCC AGATCTTTTT
TCCCTCAGTT GGAAACGTTC AGTTGTTCAC AGTTTGGCCT ATTTTCTTTT GATTGTAATT CCAGGGTTGG TCTGGTCATC
GAAGATTTAT TAGAGTAATG CCAAACACCC CTTCAGCTGT TGGACAAGCA GCATCAGGTA ACATATATGA CAATCATCCA
TTAACTTTCA TATGCTTGTT TCATGTGTAC TTTGTGATAG ATTATGTGTT ATGGTTGTCG GACTGAAAAT CACATAATCT
ATTGGTAATC AACCTTTGTT GTAAAGTTAT CAATCGACTA ATATTGTGTG TCGATATCTC TTTCAGAATA TCACTTTTTT
TTAAGGAAGA TATCACCTAT TTTAGTGAAC AACACTTTTA TATAATCCTT CCAGGAGAAA AAAAGAACTA CCATTATGTT
AAGAGTTGGG TGGTAGAATT TTTTAAATGC AAATGCTCAT ACATTTAGTA ATTGAAATCG TAGTTTATCT TCTCAAAGAA
CTGAGAATTA ATCAATTGCT GATCTCGTTG TATCTGCTAG TGATGTGTTT GGGGGAGATG GCTACTGAGA ATGATGAAAA
CCGTGTAAGA AGTTTATTCA GTGCCATTGG AAAAGTTTGG ACAGCTGAAG AAAAATATTT TGATGCTGTA ACTGGGCTAA
GGTATGTGAC TAATTTTACA GATCTTTTCT TGAAAAGCTT CACTGGAAAC AATATGTTAT GATTTTGAGA ATAAACATGT
ATTCCCATCT ATTTGAATAC AGTGGTAGTG GCCCGGCTTA TATTTTCTTA GCAATAGAGG CCATGGCTGA TGGTGGAGTT
GCTGCTGGTC TTCCTCGGGA TCTTGCACTT GGTCTTGCAT CTCAGACAGT GAGTGTTCCT TCCATAAAAT ATGTTGCGAT
ATTGTTCTAT GCTCTGGTCA CATATTCTGT TGATCTATAT AGGTTCTTGG TGCTGCAACC ATGGTAAACA AGACTGGAAA
ACATCCGGGT CAGCTGAAGG ATATGGTCAC TTCCCCGGCA GGAACCACCA TAACTGGGAT ACAAGAGCTT GAGAAGGGTG
CATTCCGTGG GACGCTGATA AATGCCGTTG TTGCTGCTAC AAAGCGTTGC CGTGAACTTT CTCAGAGTTA ATCCTCTTGT
TAGTTGTTAG TCCATTGGAT GTGCGACTCT GCGCACGATT TCCCCTAGGG AAGAGGATGT GCGAATATTG ATATTTAAAC
CTGATGAGGC TATCAGCAAA TTTTGCTTGT AGTTTTATCC GAATAATTTG CTGCACTTTA GTGGCACGAA ATCTGGATGA
TGTTAGATTG ATACTTATTC TGGCAGCAGC TGTTTTTGAT CGTTTTTGTT GGG

Locus: Os01g0948400

Loading...

Locus: Os01g0948400

Loading...