Os01t0949400-01

Locus

Os01g0949400

Description

Phytochromobilin (PΦB) synthase, Phytochrome chromophore biosynthesis, Photoperiodic response

RAP-DB Gene Symbol Synonym(s)

Se13, OsHY2

RAP-DB Gene Name Synonym(s)

Photosensitivity 13

CGSNL Gene Symbol

SE13

CGSNL Gene Name

PHOTOSENSITIVITY 13

Oryzabase Gene Symbol Synonym(s)

Se13, OsHY2, OsGUN3, GUN3, PS13

Oryzabase Gene Name Synonym(s)

Genome uncoupled 3, Photoperiod-sensitivity-13

Transcript Evidence

AK101395

Protein Evidence

Q5JKX8

Literature

PMID: 25573482

PMID: 24659905

PMID: 20700573

Note

Manual Curation

September 12, 2017

Gene Ontology (GO)

Biological Process: phytochromobilin biosynthetic process (GO:0010024)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: oxidoreductase activity, acting on the CH-CH group of donors, iron-sulfur protein as acceptor (GO:0016636)

Molecular Function: cobalt ion binding (GO:0050897)

Functional domain (InterPro)

Ferredoxin-dependent bilin reductase (IPR009249)

Full-length cDNA

J033037A10 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0949400-01)

RiceXPro (AK101395)

Others

Oryzabase (19182)

KEGG (Os01t0949400-01 (EC:1.3.7.4))

Transcript

1090 bp

>Os01t0949400-01 Phytochromobilin (PΦB) synthase, Phytochrome chromophore biosynthesis, Photoperiodic response
ACTTGCCACTGAAGAGTGGCTGCTTGCAGGCTTGGCTTGCAGCTGGGGAGAGAGCATGAG
CAGCGGCGGCGTCGGCGGCGGGAGCTTGGGCGCCGGCTTGCTGTACCACAAGTTCGTCAG
CTTCGCGCTGGAGGAGACCCGACTCCGGACCACCCTCACCCCTCACCCCTCCCAGGAAAA
GTTCAAGTCTATAAAACCCAATGATGATAATACAGTTTTCAATGCTCTCTCATTCAGTGC
ACCGAAAATTAGATTGCTTCGCAGCTTGACAATCGAGAAGAAAAACTCATATCAGGTTCT
TGACTTTGCCGCTTTCTCTGAACCTGAATACGATCTTCCTATATTTTGCGCCAACGTTTT
TACAACTCATGCACAAAGTATTGTTGTATTGGACCTCAATCCTCTATATGATACTACAGT
GCACAAGGATTACAAAGATAAGTACTATAGGAGTATAATGCCTCTTGTACACAAGTATAA
CGAGCTTCTTCCTTGGGGTGGCAAGATTACGAGTGAGTCATTGAAGTTCTTCTCTCCAAT
TGTGATCTGGACAATATTTGAGTCAACTGAACACAACCACCATGTTCTACATTCAGCTTT
CGTGGATTATTATAAGGTCTGGCTTGAATTAATGGACCAAGCAATTAAAGAAAATAACAA
AGCAACAATTGCTCGTAACCAAGAAGAACAACATAAATATCTCACATGGAGGGCTGAGAA
GGATCCTGGCTATCCCCTTTTGAAGAAGTTAATTGGTGAAAGTCGTGCCGAGGATCTGGT
GATGGAGTTTCTGTTTGAAGGAGTAAATACTCTTGGAACAAAATCATTTCTGGATTATTT
CCCTGAATACGCCCGTGATGATGGGTCAGTGAACAAGAAAAGGAGTATGATCGGCAAGTC
TTTTGAAACTAGGCCTTGGGACGCCAATGGAGAATTCATTGGCGATGCCGAAGCACAGTA
AAATGTTCGCTACGCCTTTCGGCCTGATCAATCTCTCTTATGCTTGTAGTACTGTTTTCT
TTTTTTTTAGAAAACTTACATTTTTCATGCTCATATCCCTGAACTTGGATTGAATAAGAA
GAGATTGGTG

CDS

906 bp

>Os01t0949400-01 Phytochromobilin (PΦB) synthase, Phytochrome chromophore biosynthesis, Photoperiodic response
ATGAGCAGCGGCGGCGTCGGCGGCGGGAGCTTGGGCGCCGGCTTGCTGTACCACAAGTTC
GTCAGCTTCGCGCTGGAGGAGACCCGACTCCGGACCACCCTCACCCCTCACCCCTCCCAG
GAAAAGTTCAAGTCTATAAAACCCAATGATGATAATACAGTTTTCAATGCTCTCTCATTC
AGTGCACCGAAAATTAGATTGCTTCGCAGCTTGACAATCGAGAAGAAAAACTCATATCAG
GTTCTTGACTTTGCCGCTTTCTCTGAACCTGAATACGATCTTCCTATATTTTGCGCCAAC
GTTTTTACAACTCATGCACAAAGTATTGTTGTATTGGACCTCAATCCTCTATATGATACT
ACAGTGCACAAGGATTACAAAGATAAGTACTATAGGAGTATAATGCCTCTTGTACACAAG
TATAACGAGCTTCTTCCTTGGGGTGGCAAGATTACGAGTGAGTCATTGAAGTTCTTCTCT
CCAATTGTGATCTGGACAATATTTGAGTCAACTGAACACAACCACCATGTTCTACATTCA
GCTTTCGTGGATTATTATAAGGTCTGGCTTGAATTAATGGACCAAGCAATTAAAGAAAAT
AACAAAGCAACAATTGCTCGTAACCAAGAAGAACAACATAAATATCTCACATGGAGGGCT
GAGAAGGATCCTGGCTATCCCCTTTTGAAGAAGTTAATTGGTGAAAGTCGTGCCGAGGAT
CTGGTGATGGAGTTTCTGTTTGAAGGAGTAAATACTCTTGGAACAAAATCATTTCTGGAT
TATTTCCCTGAATACGCCCGTGATGATGGGTCAGTGAACAAGAAAAGGAGTATGATCGGC
AAGTCTTTTGAAACTAGGCCTTGGGACGCCAATGGAGAATTCATTGGCGATGCCGAAGCA
CAGTAA

Protein

302 aa

>Os01t0949400-01 Phytochromobilin (PΦB) synthase, Phytochrome chromophore biosynthesis, Photoperiodic response
MSSGGVGGGSLGAGLLYHKFVSFALEETRLRTTLTPHPSQEKFKSIKPNDDNTVFNALSF
SAPKIRLLRSLTIEKKNSYQVLDFAAFSEPEYDLPIFCANVFTTHAQSIVVLDLNPLYDT
TVHKDYKDKYYRSIMPLVHKYNELLPWGGKITSESLKFFSPIVIWTIFESTEHNHHVLHS
AFVDYYKVWLELMDQAIKENNKATIARNQEEQHKYLTWRAEKDPGYPLLKKLIGESRAED
LVMEFLFEGVNTLGTKSFLDYFPEYARDDGSVNKKRSMIGKSFETRPWDANGEFIGDAEA
Q*

5'UTR

chr01:41825033..41825087 (- strand) : 55 bp

CDS

chr01:41824913..41825032 (- strand) : 120 bp

chr01:41824222..41824341 (- strand) : 120 bp

chr01:41823697..41823791 (- strand) : 95 bp

chr01:41823493..41823586 (- strand) : 94 bp

chr01:41823275..41823407 (- strand) : 133 bp

chr01:41823006..41823109 (- strand) : 104 bp

chr01:41822813..41822863 (- strand) : 51 bp

chr01:41822527..41822715 (- strand) : 189 bp

3'UTR

chr01:41822398..41822526 (- strand) : 129 bp

FASTA

>Os01t0949400-01 class=Sequence position=chr01:41822398..41825087 (- strand)
ACTTGCCACT GAAGAGTGGC TGCTTGCAGG CTTGGCTTGC AGCTGGGGAG AGAGCATGAG CAGCGGCGGC GTCGGCGGCG
GGAGCTTGGG CGCCGGCTTG CTGTACCACA AGTTCGTCAG CTTCGCGCTG GAGGAGACCC GACTCCGGAC CACCCTCACC
CCTCACCCCT CCCAGGTTCT TCTTCTTGTT GTTCTTCCTA CCTTAGCATG CTCCTTGCAG CAAAACAAAA TCTAGCTCAT
GTTCTTGCAA CCTAGTAGAG TCTACTGTTA GCTACTTGGT TCAAATACTG GTGAACTACT AGGTGCCCTT GGTTTGATGA
TTTTTTTTTC TGTCTGAAAA ACAAAATTGT AATAGTTGTG AGCTAGAGCT ACCACTACGA CCATACTGTT GCGATTGGTC
GTTACCTGAT GATTTTTTTT TTTTGCTATT GTAGACCAGC ACTGGGAAAC CTAGCTTTCA TATGTGAACA AATTAATCCC
TTGTAAACAA TGACATAACC TAATCGTTGT TTCTTTAGTC GCAACCAAGT GATTGTGATT ACTTGTTTAA TCTTGTGAAG
AAGCAGGCTA CCAAGCATAG ACATTTGATT GTGCAATTTA TTTATTTATA GTAGTATCTA TCAGAGCTAT GTCGCCCAAT
AGTGGCAGCT AGCTTCAACC ATGTTTCTAA GCCCTGTCTC AGGCTGTCAA TATTTCTGTC TCATGTAAAT GTAAGTAGTT
GACCTTGTAT TGTTTTATGC TTCCAGGAAA AGTTCAAGTC TATAAAACCC AATGATGATA ATACAGTTTT CAATGCTCTC
TCATTCAGTG CACCGAAAAT TAGATTGCTT CGCAGCTTGA CAATCGAGAA GAAAAACTCA TATCAGGTAT TTAATCTATG
TTGGGGATTT CTGTTCAAGT TTACTTGATC AAAACTCTCT TAACAATACC ACAAGTCCAC AATGTTGCTT TCCCTGACTT
ATCTCCTATT CCCCTGTGCT TTAAACATTG TCCTGGTTCT GCTTCATTGT GATTTGGAAC GTTTATATCC AGTCATAGTT
CTACAACACG ATCCACGTTA AATCTTTCGT TGATCTTTCA CTGAAAAAAA AAATGTATTG CTTTGATTTG ATCAATTTAT
GACTATTCTT TTTCTACAAT GCAACAAATT AAAAGTGTTG ACCCGCCAGC TTACGTCATG TTTTACCATT CTCCATATAA
CATGTGAAGA GTTTTGCTTG CTAGTTACAA TTGAATGCCC CATATCTCTA TCTAGGAAAA TGCTCCACTA TACTTACAAT
GCATATTCCT ATGCAGGTTC TTGACTTTGC CGCTTTCTCT GAACCTGAAT ACGATCTTCC TATATTTTGC GCCAACGTTT
TTACAACTCA TGCACAAAGT ATTGTTGTAT TGTAAGTGTC AGAGAATAGT TGCTGTTGCA AGGAAAAGTA TTGTTGGCTT
TCTTCCTTGC CTAAAACCTA ATGGATATGA GCCCTGAACG AACAATTCAA ACTATCTGCA GGGACCTCAA TCCTCTATAT
GATACTACAG TGCACAAGGA TTACAAAGAT AAGTACTATA GGAGTATAAT GCCTCTTGTA CACAAGTATA ACGAGGTACA
TGGATCTTTC CTGGCTCCAC CCAACCTATT GCCTCATAAA TTGTTATTTA GCTCGATATC TTTATTTAGA GGATATGCAG
CTTCTTCCTT GGGGTGGCAA GATTACGAGT GAGTCATTGA AGTTCTTCTC TCCAATTGTG ATCTGGACAA TATTTGAGTC
AACTGAACAC AACCACCATG TTCTACATTC AGCTTTCGTG GATTATTATA AGGCAAGACC AGACTATTTC TTTAAATTTT
CTCAAAAAGT TTAAGAGAAA CACGAAATTT GAACAAGTTT CCTGCCCTTG TTTTGTCAAT GTGAATTTTG GACTGAATTT
CTTGAAGGAT TATTCTCTTG TGTGCAGCCA TCAAATCTGA ATATTCTCAC TATGTAGGTC TGGCTTGAAT TAATGGACCA
AGCAATTAAA GAAAATAACA AAGCAACAAT TGCTCGTAAC CAAGAAGAAC AACATAAATA TCTCACATGG AGGGCTGAGA
AGGTTGTTTT TTTATTCCAT CAGAATCAGA TATCACTTTA GAAAATTATA CTCGGAGACT TGAGTATTAC TTGCCTCATT
CTGCTACTCA TCCATTGGTG TTATGAAAGA TACTATGTTG ATCTTGTGCA TCCTCTATGT GCAGGATCCT GGCTATCCCC
TTTTGAAGAA GTTAATTGGT GAAAGTCGTG CCGAGGTTTT GTCTGGGCCA TCACTACATT TATACTTACT TTTGACTTAT
ATTCTGTGTG GTGTTATTTG AATTTTGAGG TATGTATCAT CTTGACAATC AGGATCTGGT GATGGAGTTT CTGTTTGAAG
GAGTAAATAC TCTTGGAACA AAATCATTTC TGGATTATTT CCCTGAATAC GCCCGTGATG ATGGGTCAGT GAACAAGAAA
AGGAGTATGA TCGGCAAGTC TTTTGAAACT AGGCCTTGGG ACGCCAATGG AGAATTCATT GGCGATGCCG AAGCACAGTA
AAATGTTCGC TACGCCTTTC GGCCTGATCA ATCTCTCTTA TGCTTGTAGT ACTGTTTTCT TTTTTTTTAG AAAACTTACA
TTTTTCATGC TCATATCCCT GAACTTGGAT TGAATAAGAA GAGATTGGTG 

Locus: Os01g0949400

Loading...

Locus: Os01g0949400

Loading...