Os01t0952000-01

Locus

Os01g0952000

Description

Similar to Germin-like protein 1-3.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

GER8, OsGLP1-4, GLP1-4, OsGLP1-3, GLP1-3

Oryzabase Gene Name Synonym(s)

germin-like protein 8, german-like protein 1-4

Transcript Evidence

AK099691 (DDBJ, Best hit)

Protein Evidence

Q942A8 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Cellular Component: apoplast (GO:0048046)

Molecular Function: manganese ion binding (GO:0030145)

Molecular Function: nutrient reservoir activity (GO:0045735)

Functional domain (InterPro)

Germin (IPR001929)

Cupin 1 (IPR006045)

Cupin, RmlC-type (IPR011051)

RmlC-like jelly roll fold (IPR014710)

Germin, manganese binding site (IPR019780)

Full-length cDNA

J013073E02 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0952000-01)

Others

Oryzabase (15707)

KEGG (Os01t0952000-01)

Transcript

1043 bp

>Os01t0952000-01 Similar to Germin-like protein 1-3.
CATCGTCCTCAGCTCATCATCTGCATGCAGTTCACTGCACACCACACAGCTTAGCTTGCT
CAGCTTCACTGATCTTCTTAGCTGCAGCTACTTCACTTTGCATAGTTTGATCGAACTAAA
TAACTCACCAAGTTAGCTGTAATGGCCAAGCTGATCCTCGCCACCTTCGCCGTCGTGTTC
ATGGCGCTCGCCGCCACCTCCCTCGCCGGCGACCCGGACATGCTCCAGGACGTCTGCGTC
GCCGATTCTTCTTCGATGGGCTGATGAAGGCCGGGAACACGGGGAACGCGGTGGGGTCGG
TGGTGACGGCGGCGAGCGTGGAGAGCCTGCCGGGGCTGAACACGATGGGGGTGTCCATGG
CGCGTATCGACTACGCGCCATGGGGGCTGAACCCACCGCACACGCATCCCCGTGCCACCG
AGATCATCTTCGTCGTCGAGGGCTCCCTCGACGTCGGCTTCGTCACCACCGCCAACAAGC
TCTTCACCCGCACCGTCTGCAAGGGGGAGGTGTTCGTCTTCCCGCGGGGGCTCGTCCACT
TCCAGAAGAACAACGGCAACACGCCGGCGTTCGCCATCGCCGCCTTGAACAGCCAGCTCC
CCGGGACGCAGTCCATCGCCGCCGCGCTCTTCGGCGCCGCGCCGCCGCTGCCGTCGGACA
CGCTGGCCAGGGCGTTCCAGGTCGACGGCGGCATGGTCGAGTTCATCAAGTCCAAGTTCG
TCCCGCCCAAATACTAGAATTGCATTGCATGCATGCATACTGCAGGAAGAACAAGATGGC
AGCTGAGCTAGCTAGCCCTATCGCGATAATAATAATTAAGAGGACGTACGTACGTACCGT
TAAAAAGTTTGTGATTTGATTGGTAGGATTTGTGTCAGTGTGTGTTTGTGTTTGTGAGTC
GTTTGATTTGTAATTTTTATTTTTGTTTTTGAGTCGTCGTCGATCGATCGGGTCGTGTCT
CGTACTACGTGTGTGTGGTACGTGGCCGGACCTGATCATTACTGTATTATTACTTCATGG
TTTAGTACTACCACTGTTACTTC

CDS

618 bp

>Os01t0952000-01 Similar to Germin-like protein 1-3.
ATAACTCACCAAGTTAGCTGTAATGGCCAAGCTGATCCTCGCCACCTTCGCCGTCGTGTT
CATGGCGCTCGCCGCCACCTCCCTCGCCGGCGACCCGGACATGCTCCAGGACGTCTGCGT
CGCCGATTCTTCTTCGATGGGCTGATGAAGGCCGGGAACACGGGGAACGCGGTGGGGTCG
GTGGTGACGGCGGCGAGCGTGGAGAGCCTGCCGGGGCTGAACACGATGGGGGTGTCCATG
GCGCGTATCGACTACGCGCCATGGGGGCTGAACCCACCGCACACGCATCCCCGTGCCACC
GAGATCATCTTCGTCGTCGAGGGCTCCCTCGACGTCGGCTTCGTCACCACCGCCAACAAG
CTCTTCACCCGCACCGTCTGCAAGGGGGAGGTGTTCGTCTTCCCGCGGGGGCTCGTCCAC
TTCCAGAAGAACAACGGCAACACGCCGGCGTTCGCCATCGCCGCCTTGAACAGCCAGCTC
CCCGGGACGCAGTCCATCGCCGCCGCGCTCTTCGGCGCCGCGCCGCCGCTGCCGTCGGAC
ACGCTGGCCAGGGCGTTCCAGGTCGACGGCGGCATGGTCGAGTTCATCAAGTCCAAGTTC
GTCCCGCCCAAATACTAG

Protein

206 aa

>Os01t0952000-01 Similar to Germin-like protein 1-3.
ITHQVSCNGQADPRHLRRRVHGARRHLPRRRPGHAPGRLRRRFFFDGLMKAGNTGNAVGS
VVTAASVESLPGLNTMGVSMARIDYAPWGLNPPHTHPRATEIIFVVEGSLDVGFVTTANK
LFTRTVCKGEVFVFPRGLVHFQKNNGNTPAFAIAALNSQLPGTQSIAAALFGAAPPLPSD
TLARAFQVDGGMVEFIKSKFVPPKY*

5'UTR

chr01:41914683..41914801 (+ strand) : 119 bp

CDS

chr01:41914802..41914927 (+ strand) : 126 bp

chr01:41915124..41915615 (+ strand) : 492 bp

3'UTR

chr01:41915616..41915921 (+ strand) : 306 bp

FASTA

>Os01t0952000-01 class=Sequence position=chr01:41914683..41915921 (+ strand)
CATCGTCCTC AGCTCATCAT CTGCATGCAG TTCACTGCAC ACCACACAGC TTAGCTTGCT CAGCTTCACT GATCTTCTTA
GCTGCAGCTA CTTCACTTTG CATAGTTTGA TCGAACTAAA TAACTCACCA AGTTAGCTGT AATGGCCAAG CTGATCCTCG
CCACCTTCGC CGTCGTGTTC ATGGCGCTCG CCGCCACCTC CCTCGCCGGC GACCCGGACA TGCTCCAGGA CGTCTGCGTC
GCCGACTACA AGTCCCTCAA AGGCCGTAAG TGTTGGACCA TTATTGTTCA TCGATTCATA AAATATGAAT TGACCTATTT
TTTTTTAACG ACCCGTACAA GACAGTGCGA AGATTCATAT TAACGTATAT ATGTATGTCG TGCAGCGCTG CGGCTGAACG
GGTTCCCGTG CAAGAGGATA GAGAACGTGA CGGCGAACGA CTTCTTCTTC GATGGGCTGA TGAAGGCCGG GAACACGGGG
AACGCGGTGG GGTCGGTGGT GACGGCGGCG AGCGTGGAGA GCCTGCCGGG GCTGAACACG ATGGGGGTGT CCATGGCGCG
TATCGACTAC GCGCCATGGG GGCTGAACCC ACCGCACACG CATCCCCGTG CCACCGAGAT CATCTTCGTC GTCGAGGGCT
CCCTCGACGT CGGCTTCGTC ACCACCGCCA ACAAGCTCTT CACCCGCACC GTCTGCAAGG GGGAGGTGTT CGTCTTCCCG
CGGGGGCTCG TCCACTTCCA GAAGAACAAC GGCAACACGC CGGCGTTCGC CATCGCCGCC TTGAACAGCC AGCTCCCCGG
GACGCAGTCC ATCGCCGCCG CGCTCTTCGG CGCCGCGCCG CCGCTGCCGT CGGACACGCT GGCCAGGGCG TTCCAGGTCG
ACGGCGGCAT GGTCGAGTTC ATCAAGTCCA AGTTCGTCCC GCCCAAATAC TAGAATTGCA TTGCATGCAT GCATACTGCA
GGAAGAACAA GATGGCAGCT GAGCTAGCTA GCCCTATCGC GATAATAATA ATTAAGAGGA CGTACGTACG TACCGTTAAA
AAGTTTGTGA TTTGATTGGT AGGATTTGTG TCAGTGTGTG TTTGTGTTTG TGAGTCGTTT GATTTGTAAT TTTTATTTTT
GTTTTTGAGT CGTCGTCGAT CGATCGGGTC GTGTCTCGTA CTACGTGTGT GTGGTACGTG GCCGGACCTG ATCATTACTG
TATTATTACT TCATGGTTTA GTACTACCAC TGTTACTTC

Locus: Os01g0952000

Loading...

Locus: Os01g0952000

Loading...