Os01t0952000-02

Locus

Os01g0952000

Description

RmlC-like jelly roll fold domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

GER8, OsGLP1-4, GLP1-4, OsGLP1-3, GLP1-3

Oryzabase Gene Name Synonym(s)

germin-like protein 8, german-like protein 1-4

Transcript Evidence

AK060864 (DDBJ, Best hit)

Protein Evidence

Q942A8 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Cellular Component: apoplast (GO:0048046)

Molecular Function: manganese ion binding (GO:0030145)

Molecular Function: nutrient reservoir activity (GO:0045735)

Functional domain (InterPro)

Germin (IPR001929)

Cupin 1 (IPR006045)

Cupin, RmlC-type (IPR011051)

RmlC-like jelly roll fold (IPR014710)

Germin, manganese binding site (IPR019780)

Full-length cDNA

001-034-G07 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0952000-02)

RiceXPro (AK060864)

Others

Oryzabase (15707)

KEGG (Os01t0952000-02)

Transcript

1118 bp

>Os01t0952000-02 RmlC-like jelly roll fold domain containing protein.
ATCGTCCTCAGCTCATCATCTGCATGCAGTTCACTGCACACCACACAGCTTAGCTTGCTC
AGCTTCACTGATCTTCTTAGCTGCAGCTACTTCACTTTGCATAGTTTGATCGAACTAAAT
AACTCACCAAGTTAGCTGTAATGGCCAAGCTGATCCTCGCCACCTTCGCCGTCGTGTTCA
TGGCGCTCGCCGCCACCTCCCTCGCCGGCGACCCGGACATGCTCCAGGACGTCTGCGTCG
CCGACTACAAGTCCCTCAAAGGCCCGCTGCGGCTGAACGGGTTCCCGTGCAAGAGGATAG
AGAACGTGACGGCGAACGACTTCTTCTTCGATGGGCTGATGAAGGCCGGGAACACGGGGA
ACGCGGTGGGGTCGGTGGTGACGGCGGCGAGCGTGGAGAGCCTGCCGGGGCTGAACACGA
TGGGGGTGTCCATGGCGCGTATCGACTACGCGCCATGGGGGCTGAACCCACCGCACACGC
ATCCCCGTGCCACCGAGATCATCTTCGTCGTCGAGGGCTCCCTCGACGTCGGCTTCGTCA
CCACCGCCAACAAGCTCTTCACCCGCACCGTCTGCAAGGGGGAGGTGTTCGTCTTCCCGC
GGGGGCTCGTCCACTTCCAGAAGAACAACGGCAACACGCCGGCGTTCGCCATCGCCGCCT
TGAACAGCCAGCTCCCCGGGACGCAGTCCATCGCCGCCGCGCTCTTCGGCGCCGCGCCGC
CGCTGCCGTCGGACACGCTGGCCAGGGCGTTCCAGGTCGACGGCGGCATGGTCGAGTTCA
TCAAGTCCAAGTTCGTCCCGCCCAAATACTAGAATTGCATTGCATGCATGCATACTGCAG
GAAGAACAAGATGGCAGCTGAGCTAGCTAGCCCTATCGCGATAATAATAATTAAGAGGAC
GTACGTACGTACCGTTAAAAAGTTTGTGATTTGATTGGTAGGATTTGTGTCAGTGTGTGT
TTGTGTTTGTGAGTCGTTTGATTTGTAATTTTTATTTTTGTTTTTGAGTCGTCGTCGATC
GATCGGGTCGTGTCTCGTACTACGTGTGTGTGGTACGTGGCCGGACCTGATCATTACTGT
ATTATTACTTCATGGTTTAGTACTACCACTGTTACTTC

CDS

672 bp

>Os01t0952000-02 RmlC-like jelly roll fold domain containing protein.
ATGGCCAAGCTGATCCTCGCCACCTTCGCCGTCGTGTTCATGGCGCTCGCCGCCACCTCC
CTCGCCGGCGACCCGGACATGCTCCAGGACGTCTGCGTCGCCGACTACAAGTCCCTCAAA
GGCCCGCTGCGGCTGAACGGGTTCCCGTGCAAGAGGATAGAGAACGTGACGGCGAACGAC
TTCTTCTTCGATGGGCTGATGAAGGCCGGGAACACGGGGAACGCGGTGGGGTCGGTGGTG
ACGGCGGCGAGCGTGGAGAGCCTGCCGGGGCTGAACACGATGGGGGTGTCCATGGCGCGT
ATCGACTACGCGCCATGGGGGCTGAACCCACCGCACACGCATCCCCGTGCCACCGAGATC
ATCTTCGTCGTCGAGGGCTCCCTCGACGTCGGCTTCGTCACCACCGCCAACAAGCTCTTC
ACCCGCACCGTCTGCAAGGGGGAGGTGTTCGTCTTCCCGCGGGGGCTCGTCCACTTCCAG
AAGAACAACGGCAACACGCCGGCGTTCGCCATCGCCGCCTTGAACAGCCAGCTCCCCGGG
ACGCAGTCCATCGCCGCCGCGCTCTTCGGCGCCGCGCCGCCGCTGCCGTCGGACACGCTG
GCCAGGGCGTTCCAGGTCGACGGCGGCATGGTCGAGTTCATCAAGTCCAAGTTCGTCCCG
CCCAAATACTAG

Protein

224 aa

>Os01t0952000-02 RmlC-like jelly roll fold domain containing protein.
MAKLILATFAVVFMALAATSLAGDPDMLQDVCVADYKSLKGPLRLNGFPCKRIENVTAND
FFFDGLMKAGNTGNAVGSVVTAASVESLPGLNTMGVSMARIDYAPWGLNPPHTHPRATEI
IFVVEGSLDVGFVTTANKLFTRTVCKGEVFVFPRGLVHFQKNNGNTPAFAIAALNSQLPG
TQSIAAALFGAAPPLPSDTLARAFQVDGGMVEFIKSKFVPPKY*

5'UTR

chr01:41914684..41914823 (+ strand) : 140 bp

CDS

chr01:41914824..41914947 (+ strand) : 124 bp

chr01:41915068..41915615 (+ strand) : 548 bp

3'UTR

chr01:41915616..41915921 (+ strand) : 306 bp

FASTA

>Os01t0952000-02 class=Sequence position=chr01:41914684..41915921 (+ strand)
ATCGTCCTCA GCTCATCATC TGCATGCAGT TCACTGCACA CCACACAGCT TAGCTTGCTC AGCTTCACTG ATCTTCTTAG
CTGCAGCTAC TTCACTTTGC ATAGTTTGAT CGAACTAAAT AACTCACCAA GTTAGCTGTA ATGGCCAAGC TGATCCTCGC
CACCTTCGCC GTCGTGTTCA TGGCGCTCGC CGCCACCTCC CTCGCCGGCG ACCCGGACAT GCTCCAGGAC GTCTGCGTCG
CCGACTACAA GTCCCTCAAA GGCCGTAAGT GTTGGACCAT TATTGTTCAT CGATTCATAA AATATGAATT GACCTATTTT
TTTTTAACGA CCCGTACAAG ACAGTGCGAA GATTCATATT AACGTATATA TGTATGTCGT GCAGCGCTGC GGCTGAACGG
GTTCCCGTGC AAGAGGATAG AGAACGTGAC GGCGAACGAC TTCTTCTTCG ATGGGCTGAT GAAGGCCGGG AACACGGGGA
ACGCGGTGGG GTCGGTGGTG ACGGCGGCGA GCGTGGAGAG CCTGCCGGGG CTGAACACGA TGGGGGTGTC CATGGCGCGT
ATCGACTACG CGCCATGGGG GCTGAACCCA CCGCACACGC ATCCCCGTGC CACCGAGATC ATCTTCGTCG TCGAGGGCTC
CCTCGACGTC GGCTTCGTCA CCACCGCCAA CAAGCTCTTC ACCCGCACCG TCTGCAAGGG GGAGGTGTTC GTCTTCCCGC
GGGGGCTCGT CCACTTCCAG AAGAACAACG GCAACACGCC GGCGTTCGCC ATCGCCGCCT TGAACAGCCA GCTCCCCGGG
ACGCAGTCCA TCGCCGCCGC GCTCTTCGGC GCCGCGCCGC CGCTGCCGTC GGACACGCTG GCCAGGGCGT TCCAGGTCGA
CGGCGGCATG GTCGAGTTCA TCAAGTCCAA GTTCGTCCCG CCCAAATACT AGAATTGCAT TGCATGCATG CATACTGCAG
GAAGAACAAG ATGGCAGCTG AGCTAGCTAG CCCTATCGCG ATAATAATAA TTAAGAGGAC GTACGTACGT ACCGTTAAAA
AGTTTGTGAT TTGATTGGTA GGATTTGTGT CAGTGTGTGT TTGTGTTTGT GAGTCGTTTG ATTTGTAATT TTTATTTTTG
TTTTTGAGTC GTCGTCGATC GATCGGGTCG TGTCTCGTAC TACGTGTGTG TGGTACGTGG CCGGACCTGA TCATTACTGT
ATTATTACTT CATGGTTTAG TACTACCACT GTTACTTC

Locus: Os01g0952000

Loading...

Locus: Os01g0952000

Loading...