Os01t0955000-02

Locus

Os01g0955000

Description

Phosphoesterase family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

NPC2

CGSNL Gene Name

NON-SPECIFIC PHOSPHOLIPASE C2

Oryzabase Gene Symbol Synonym(s)

OsNPC2

Oryzabase Gene Name Synonym(s)

Non-specific phospholipase C2

Transcript Evidence

AK101291 (DDBJ, Best hit)

AK119633 (DDBJ, Best hit)

Protein Evidence

XP_002880842.1 (RefSeq)

Literature

Note

Manual Curation

Full-length cDNA

J033033G16 (Online Clone Ordering)

002-130-E12 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0955000-02)

RiceXPro (AK101291)

Others

Oryzabase (21049)

KEGG (Os01t0955000-02 (EC:3.1.4.3))

Transcript

1871 bp

>Os01t0955000-02 Phosphoesterase family protein.
GGGTCCATCACGAGCTCCCCTCCCCACACACCACCTCACTCCCACTACGAGAGAGGAGGA
AGCTCGCAATCATCGAATCAATGGCGGTTCGCCGCCGGCGACCCGGCCCCGTGGCGGCCG
CCGTGCTGCTGCTACTCGCGGTGGCGACCCAGGCGGCGGCGAGCccgataaagacggtgg
tggtggtggtgatggagaaccggtcgttcgaccacatgctGGGGTGGATGAAGCGGCTGA
ACCCGGAGATCGACGGCGTGACCGGCGGCGAGTGGAACCCGACGAACGCCAGCGACCCGT
CGTCGGGGCGCGTCTACTTCGGCGAGGGCGCCGAGTACGTGGACCCAGACCCGGGCCACT
CGTTCCAGGAGATCCGGCAGCAGATATTCGGGTCGGACGACGCGTCGGGGCCGGCGAGGA
TGGACGGCTTCGTGCAGCAGGCGCGGTCGCTGGGGGACAACATGACGGCGGCCGTCATGA
ACGGCTTCTCGCCGGACAGCGTCGCCGTGTACCGGGAGCTCGTCGGGGAGTTCGCGGTGT
TCGACCGGTGGTTCGCGTCCGTGCCGTCGTCGACGCAGCCCAACCGACTGTTCGTGCACT
CCGCCACATCCGGCGGCGCCACCAGCAACAACCCAGAGCTGCTGGCGAAGGGCTACCCGC
AGCGTACAATCTTCGACAACGTGCACGACGCCGGGCTGTCGTTCGGGGTCTACTACCAGG
ACGTGCCGGCGGTGCTCTTCTACCGCAACCTGCGGAAGCTCAAGTACCTGACCAAGTTCC
ACCCGTTCCACGGCGCGTTCCGCGACCACGCCGCCCGCGGCTCCCTCCCAAACTACGCCG
TGGTGGAGCAGCACTACATGGACTCCAAGTCCCACCCGGCCAACGACGACCACCCGTCGC
ACGACGTCTTCCAGGGCCAGATGCTCGTCAAGGAGGTGTACGAGACGCTCCGCGCCAGCC
CGCAGTGGAACCAGACGCTCATGGTCGTCACCTACGACGAGCACGGCGGCTTCTACGACC
ATGTCCCCACCCCCGTCACCGGCGTCCCCAGCCCCGACGGCATCGTCGGCCCGCCGCCGT
ATAACTTCGCCTTTGATCGCCTCGGCGTCCGTGTCCCAGCCATCGTCATCTCCCCCTGGA
TCAACAAGGGTACAGTTGTTCATGGGCCAAACGGGAGCCCAACCGCGACGTCGGAGTACG
AGCACTCGTCCATCCCCGCGACCGTGAAGAAACTCTTCGATCTGCCACAGGATTTCCTGA
CTAAAAGGGACGCCTGGGCTGGAACGTTTGAGAGTGTCGTGCAAGGCAGAACTGAGCCAA
GGACGGATTGCCCAGAGCAACTCCCAATGCCGATGAGGATACGGCTGACGGAGGCGAACG
AGGAGGCGAAGCTGAGTGAGTTCCAGCAGGAGCTGGTTCAGCTGGCGTCGGTGCTCAACG
GGGACCACCAGCTGAGCAGCCTGCAGGACACGATCAGGGACAGGATGAACGTCAGGGAAG
GCATCGCGTACATGCGGGGCGCTGTAAAGCGCTTCTTCGAGACCGGCATGTCAGCCAAGA
GGATGGGCGTCGACGACGAGCAGATCGTCAAGATGAGGCCATCGCTCACCACCAGGACAT
CCCCTGCGATCGAGCAACCATAGAAATAGAAACAAGAGCAATAGAAGCAAATAAGGATAC
AGGTTTATTTTATATGCTGAAAAAGAAAAAAAATCATGGTGCTTGCATATATGTAGCAGA
GCCAGCAAGGAGTGCTTTGTTCTAGAATTAGTTGAGATCTCTCATGGATCGATCTATATA
CATGGCCGGGCTGTACTGTACAAATTGATGAAACGTTAATTATTGGCTTAGTATACAGAT
CGATCGATTGC

CDS

1563 bp

>Os01t0955000-02 Phosphoesterase family protein.
ATGGCGGTTCGCCGCCGGCGACCCGGCCCCGTGGCGGCCGCCGTGCTGCTGCTACTCGCG
GTGGCGACCCAGGCGGCGGCGAGCccgataaagacggtggtggtggtggtgatggagaac
cggtcgttcgaccacatgctGGGGTGGATGAAGCGGCTGAACCCGGAGATCGACGGCGTG
ACCGGCGGCGAGTGGAACCCGACGAACGCCAGCGACCCGTCGTCGGGGCGCGTCTACTTC
GGCGAGGGCGCCGAGTACGTGGACCCAGACCCGGGCCACTCGTTCCAGGAGATCCGGCAG
CAGATATTCGGGTCGGACGACGCGTCGGGGCCGGCGAGGATGGACGGCTTCGTGCAGCAG
GCGCGGTCGCTGGGGGACAACATGACGGCGGCCGTCATGAACGGCTTCTCGCCGGACAGC
GTCGCCGTGTACCGGGAGCTCGTCGGGGAGTTCGCGGTGTTCGACCGGTGGTTCGCGTCC
GTGCCGTCGTCGACGCAGCCCAACCGACTGTTCGTGCACTCCGCCACATCCGGCGGCGCC
ACCAGCAACAACCCAGAGCTGCTGGCGAAGGGCTACCCGCAGCGTACAATCTTCGACAAC
GTGCACGACGCCGGGCTGTCGTTCGGGGTCTACTACCAGGACGTGCCGGCGGTGCTCTTC
TACCGCAACCTGCGGAAGCTCAAGTACCTGACCAAGTTCCACCCGTTCCACGGCGCGTTC
CGCGACCACGCCGCCCGCGGCTCCCTCCCAAACTACGCCGTGGTGGAGCAGCACTACATG
GACTCCAAGTCCCACCCGGCCAACGACGACCACCCGTCGCACGACGTCTTCCAGGGCCAG
ATGCTCGTCAAGGAGGTGTACGAGACGCTCCGCGCCAGCCCGCAGTGGAACCAGACGCTC
ATGGTCGTCACCTACGACGAGCACGGCGGCTTCTACGACCATGTCCCCACCCCCGTCACC
GGCGTCCCCAGCCCCGACGGCATCGTCGGCCCGCCGCCGTATAACTTCGCCTTTGATCGC
CTCGGCGTCCGTGTCCCAGCCATCGTCATCTCCCCCTGGATCAACAAGGGTACAGTTGTT
CATGGGCCAAACGGGAGCCCAACCGCGACGTCGGAGTACGAGCACTCGTCCATCCCCGCG
ACCGTGAAGAAACTCTTCGATCTGCCACAGGATTTCCTGACTAAAAGGGACGCCTGGGCT
GGAACGTTTGAGAGTGTCGTGCAAGGCAGAACTGAGCCAAGGACGGATTGCCCAGAGCAA
CTCCCAATGCCGATGAGGATACGGCTGACGGAGGCGAACGAGGAGGCGAAGCTGAGTGAG
TTCCAGCAGGAGCTGGTTCAGCTGGCGTCGGTGCTCAACGGGGACCACCAGCTGAGCAGC
CTGCAGGACACGATCAGGGACAGGATGAACGTCAGGGAAGGCATCGCGTACATGCGGGGC
GCTGTAAAGCGCTTCTTCGAGACCGGCATGTCAGCCAAGAGGATGGGCGTCGACGACGAG
CAGATCGTCAAGATGAGGCCATCGCTCACCACCAGGACATCCCCTGCGATCGAGCAACCA
TAG

Protein

521 aa

>Os01t0955000-02 Phosphoesterase family protein.
MAVRRRRPGPVAAAVLLLLAVATQAAASPIKTVVVVVMENRSFDHMLGWMKRLNPEIDGV
TGGEWNPTNASDPSSGRVYFGEGAEYVDPDPGHSFQEIRQQIFGSDDASGPARMDGFVQQ
ARSLGDNMTAAVMNGFSPDSVAVYRELVGEFAVFDRWFASVPSSTQPNRLFVHSATSGGA
TSNNPELLAKGYPQRTIFDNVHDAGLSFGVYYQDVPAVLFYRNLRKLKYLTKFHPFHGAF
RDHAARGSLPNYAVVEQHYMDSKSHPANDDHPSHDVFQGQMLVKEVYETLRASPQWNQTL
MVVTYDEHGGFYDHVPTPVTGVPSPDGIVGPPPYNFAFDRLGVRVPAIVISPWINKGTVV
HGPNGSPTATSEYEHSSIPATVKKLFDLPQDFLTKRDAWAGTFESVVQGRTEPRTDCPEQ
LPMPMRIRLTEANEEAKLSEFQQELVQLASVLNGDHQLSSLQDTIRDRMNVREGIAYMRG
AVKRFFETGMSAKRMGVDDEQIVKMRPSLTTRTSPAIEQP*

5'UTR

chr01:42067705..42067784 (- strand) : 80 bp

CDS

chr01:42067148..42067704 (- strand) : 557 bp

chr01:42064201..42064718 (- strand) : 518 bp

chr01:42063904..42064083 (- strand) : 180 bp

chr01:42063489..42063796 (- strand) : 308 bp

3'UTR

chr01:42063261..42063488 (- strand) : 228 bp

FASTA

>Os01t0955000-02 class=Sequence position=chr01:42063261..42067784 (- strand)
GGGTCCATCA CGAGCTCCCC TCCCCACACA CCACCTCACT CCCACTACGA GAGAGGAGGA AGCTCGCAAT CATCGAATCA
ATGGCGGTTC GCCGCCGGCG ACCCGGCCCC GTGGCGGCCG CCGTGCTGCT GCTACTCGCG GTGGCGACCC AGGCGGCGGC
GAGCccgata aagacggtgg tggtggtggt gatggagaac cggtcgttcg accacatgct GGGGTGGATG AAGCGGCTGA
ACCCGGAGAT CGACGGCGTG ACCGGCGGCG AGTGGAACCC GACGAACGCC AGCGACCCGT CGTCGGGGCG CGTCTACTTC
GGCGAGGGCG CCGAGTACGT GGACCCAGAC CCGGGCCACT CGTTCCAGGA GATCCGGCAG CAGATATTCG GGTCGGACGA
CGCGTCGGGG CCGGCGAGGA TGGACGGCTT CGTGCAGCAG GCGCGGTCGC TGGGGGACAA CATGACGGCG GCCGTCATGA
ACGGCTTCTC GCCGGACAGC GTCGCCGTGT ACCGGGAGCT CGTCGGGGAG TTCGCGGTGT TCGACCGGTG GTTCGCGTCC
GTGCCGTCGT CGACGCAGCC CAACCGACTG TTCGTGCACT CCGCCACATC CGGCGGCGCC ACCAGCAACA ACCCAGAGTA
CGTGCATTAT TATTAACCTT CTCCTACTAT TTCCGCGTGA TATCGCTTTT GATGATTCGA TATCTATCTT TGGGCTGGCC
GCGACAAATG CGTTCTGATT CGATCGATAT ATCGTTTGCG TGTGGACGTA CGTGATCGAA TTCCAACCAT CGTAGTATAG
TTATTTCAAT CTGCTGGGTT TGGTGGCCAA AATTATTGAT GATGGATCAA TGGTGTTCAG ACTCGAGATG AGCTGTTGTT
GCACTTGCAC ACTAGGATAC GCACAAACTA AATGCGGCCG TAGTAGTTAA AAGAGTTGCA TTTTGAACCA AACAGATGCC
ATCTTTTGCT TAATCTGTTC AATTTTGGAT AGTGGTGATA GTTATTTTTC CTTTTAGCCA TAGTACTGAT AGTTCTGCTA
GCATAATTAA CCTTGTAGAA TCTGAACTGC GGTTGTACGT ACAATATACT GTGGGTAGTA TCTGAATTTT GAAATATATA
TACTGCGGGT AGTATCTGAA GTACTCACTA AGTTCAGGTA TCAGTTGTCA ACTAGCGGTC AAATTGCACC CTTTTTTTTT
TCAAAGTCAC GTGGCGATTT TACGCCTGCG CCTCTACACG CAATTAAGGG GATTCTCTGC TGCAAGCACA AGCTAGCTTC
TTCTGCTGAC GTACAGTAGA AACATTGCTA GAGTTCTCTC TGTCTTGTTC CTTTCCATTC AAAAGTACAC TAGGATATCA
GAGTCACACA GAGCAGTCAC TGTATGTACC ATTTTTGGGC GGTGCTTTGT GCTTCCCTGT ACAAAATCTG AAAGAGAAAG
ATTGTACTAG GCAGAAAGCC GACCTACCAA TACCATAGTA AAGTTTAAAT TCTTGTGGTC GCTCAACGTT CTAGCTTGCA
CCTGCCATGC ACAAAGATGA TGGCGCCCAA ATGGCCAAAT CATTTTTTCA ATATGACAAT GAATCCATTT GATGCCCGAG
GTGACCTAAT CAACTTGGGT TAGCCGAACG ATTCATCAAA AGGAGcaagt ttgtcaggat cgggatacta gttagtatcg
ttttgctcaa agtaatatcg tatcgtatga tcgggatact ataagatttt cttttttaag tttaattaat atttatatta
aatatatata gccattctgt ataaaaaaat atagtaatga tatatatcat gcaaatagag acatttatca agagaaacca
cgttggtttt gatatattta actgattttt atataaattt gagcatattt aggtacatta tttttaaacc atgttattta
aaataatatt ttgtagtatc gtagggatcg tagaatcggg ataccaccta agatttcgta ggatcgtgta gtaatgaata
gtaggatcga gatactatga aaattaagat actaggtggg atcgatatcg tttcggcttg gtataggatt gtagtatcgt
aagatactag gatacgaatc gggatattga caacattgAA AAGGAGCATC ACATGCCCTG CAACTGCAAG AGCACTAACA
TCGATTAGTC TCCTGTCGGC ATCATCAAGA TAGAACGATG CCAATTATGC CACTATCAGC ACCAGGATTT GTTTGGAAAA
GAAACTCATT ATGCCATCCA CTTGTCATTA GACAGGAGTA CTACGGTACT AAGTTAAAAA AAACAATAGC ACTAGCACGG
ATTTCAAATC GGGGTATATA TGTCGCGGGC AGCCTTTGAT TAGTTAATTT TCTTATGGGC CGTGCGTTGT TGATTAATTC
CCTGCTTTTG CCCTTCGCTT TTGCTGTCGC GTGCTCCAGA CCATCGATCA GGTTAACGCA TTACGGTGAA CATGGATTAA
ATTAGTCACT AAGACATCGA TGGCTGGATC CACCGTCCAT GTGAAAGCAG TCGAGGGAAA GGAGGCACGC AACGTCGAGA
GAATGGTGGT CCCCTTTCGA TCCATGGCTG ACTGACACTG CTCATCGTCT CGCTACTAAC CATGGGTACA GTTTGAATGG
CCCCACCTGA CAGTGAAATA GATTTTAGTG ACAAGCACCG GATCGGATCA GAAATACGTG TCAGGAGGCA AGACACACAC
CTGGCCTGCT GGCCCATGAT CGGAAACCCT TAAAAAAACA AGTGAATGGT ACAGTAATGT ATTGCGGTGA CAGCGCCAAC
CACGACTTGT GTCGGTGCGT GGGGTCTGGT GAGTCGTAAG AAACCGAGAA GATTCCTGGA TTCCACCGAG TTCATGCCGT
GTCAAGAAAA AAAAATAAAT TAAGAACTGG GCTACGAATT AGTAGTGCCT AATGGGCTAC GAACTTAAGA GAAGAAAGAA
CAGTTTGGGC CGGTACATGG ATTCGGCCCA ATTCGGGCAC TTCAGTTTTT GATGATCGAT CAAACTAATA AAAACTTGGT
TGGCGTGTGT GTTTTTGGTC GTGCAGGCTG CTGGCGAAGG GCTACCCGCA GCGTACAATC TTCGACAACG TGCACGACGC
CGGGCTGTCG TTCGGGGTCT ACTACCAGGA CGTGCCGGCG GTGCTCTTCT ACCGCAACCT GCGGAAGCTC AAGTACCTGA
CCAAGTTCCA CCCGTTCCAC GGCGCGTTCC GCGACCACGC CGCCCGCGGC TCCCTCCCAA ACTACGCCGT GGTGGAGCAG
CACTACATGG ACTCCAAGTC CCACCCGGCC AACGACGACC ACCCGTCGCA CGACGTCTTC CAGGGCCAGA TGCTCGTCAA
GGAGGTGTAC GAGACGCTCC GCGCCAGCCC GCAGTGGAAC CAGACGCTCA TGGTCGTCAC CTACGACGAG CACGGCGGCT
TCTACGACCA TGTCCCCACC CCCGTCACCG GCGTCCCCAG CCCCGACGGC ATCGTCGGCC CGCCGCCGTA TAACTTCGCC
TTTGATCGCC TCGGCGTCCG TGTCCCAGCC ATCGTCATCT CCCCCTGGAT CAACAAGGGT ACAGGTCAGT GATGAGTAGT
AACGACTATT TTTGCTGTTA CTGTGCCTAA CTAAGCTTTG ACTGCGTGCC TGCTTAATTA GTGTGTTTTG AACTGACAAT
TGTTGTGTTG ATATTTTTCA GTTGTTCATG GGCCAAACGG GAGCCCAACC GCGACGTCGG AGTACGAGCA CTCGTCCATC
CCCGCGACCG TGAAGAAACT CTTCGATCTG CCACAGGATT TCCTGACTAA AAGGGACGCC TGGGCTGGAA CGTTTGAGAG
TGTCGTGCAA GGCAGAACTG AGCCAAGGAC GGATTGCCCA GGTAAGACGG CCATGTTCAG TTGCGTACTG CGAATGTATG
TAATGTAGTA ATAGTCTTCA GAAGTTGTTC ACTTGGCACT GCCTTTTTAT CCTTGATGCA AAATGCAGAG CAACTCCCAA
TGCCGATGAG GATACGGCTG ACGGAGGCGA ACGAGGAGGC GAAGCTGAGT GAGTTCCAGC AGGAGCTGGT TCAGCTGGCG
TCGGTGCTCA ACGGGGACCA CCAGCTGAGC AGCCTGCAGG ACACGATCAG GGACAGGATG AACGTCAGGG AAGGCATCGC
GTACATGCGG GGCGCTGTAA AGCGCTTCTT CGAGACCGGC ATGTCAGCCA AGAGGATGGG CGTCGACGAC GAGCAGATCG
TCAAGATGAG GCCATCGCTC ACCACCAGGA CATCCCCTGC GATCGAGCAA CCATAGAAAT AGAAACAAGA GCAATAGAAG
CAAATAAGGA TACAGGTTTA TTTTATATGC TGAAAAAGAA AAAAAATCAT GGTGCTTGCA TATATGTAGC AGAGCCAGCA
AGGAGTGCTT TGTTCTAGAA TTAGTTGAGA TCTCTCATGG ATCGATCTAT ATACATGGCC GGGCTGTACT GTACAAATTG
ATGAAACGTT AATTATTGGC TTAGTATACA GATCGATCGA TTGC

Locus: Os01g0955000

Loading...

Locus: Os01g0955000

Loading...