Os01t0955000-03

Locus

Os01g0955000

Description

Similar to phosphoesterase family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

NPC2

CGSNL Gene Name

NON-SPECIFIC PHOSPHOLIPASE C2

Oryzabase Gene Symbol Synonym(s)

OsNPC2

Oryzabase Gene Name Synonym(s)

Non-specific phospholipase C2

Transcript Evidence

AK111280 (DDBJ, Best hit)

Protein Evidence

XP_002880842.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: hydrolase activity, acting on ester bonds (GO:0016788)

Functional domain (InterPro)

Phosphoesterase (IPR007312)

Full-length cDNA

002-180-H03 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0955000-03)

RiceXPro (AK111280)

Others

Oryzabase (21049)

KEGG (Os01t0955000-03 (EC:3.1.4.3))

Transcript

1498 bp

>Os01t0955000-03 Similar to phosphoesterase family protein.
ATCACGAGCTCCCCTCCCCACACACCACCTCACTCCCACTACGAGAGAGGAGGAAGCTCG
CAATCATCGAATCAATGGCGGTTCGCCGCCGGCGACCCGGCCCCGTGGCGGCCGCCGTGC
TGCTGCTACTCGCGGTGGCGACCCAGGCGGCGGCGAGCccgataaagacggtggtggtgg
tggtgatggagaaccggtcgttcgaccacatgctGGGGTGGATGAAGCGGCTGAACCCGG
AGATCGACGGCGTGACCGGCGGCGAGTGGAACCCGACGAACGCCAGCGACCCGTCGTCGG
GGCGCGTCTACTTCGGCGAGGGCGCCGAGTACGTGGACCCAGACCCGGGCCACTCGTTCC
AGGAGATCCGGCAGCAGATATTCGGGTCGGACGACGCGTCGGGGCCGGCGAGGATGGACG
GCTTCGTGCAGCAGGCGCGGTCGCTGGGGGACAACATGACGGCGGCCGTCATGAACGGCT
TCTCGCCGGACAGCGTCGCCGTGTACCGGGAGCTCGTCGGGGAGTTCGCGGTGTTCGACC
GGTGGTTCGCGTCCGTGCCGTCGTCGACGCAGCCCAACCGACTGTTCGTGCACTCCGCCA
CATCCGGCGGCGCCACCAGCAACAACCCAGAGTACGTGCATTATTATTAACCTTCTCCTA
CTATTTCCGCGTGATATCGCTTTTGATGATTCGATATCTATCTTTGGGCTGGCCGCGACA
AATGCGTTCTGATTCGATCGATATATCGTTTGCGTGTGGACGTACGTGATCGAATTCCAA
CCATCGTAGTATAGTTATTTCAATCTGCTGGGTTTGGTGGCCAAAATTATTGATGATGGA
TCAATGGTGTTCAGACTCGAGATGAGCTGTTGTTGCACTTGCACACTAGGATACGCACAA
ACTAAATGCGGCCGTAGTAGTTAAAAGAGTTGCATTTTGAACCAAACAGATGCCATCTTT
TGCTTAATCTGTTCAATTTTGGATAGTGGTGATAGTTATTTTTCCTTTTAGCCATAGTAC
TGATAGTTCTGCTAGCATAATTAACCTTGTAGAATCTGAACTGCGGTTGTACGTACAATA
TACTGTGGGTAGTATCTGAATTTTGAAATATATATACTGCGGGTAGTATCTGAAGTACTC
ACTAAGTTCAGGTATCAGTTGTCAACTAGCGGTCAAATTGCACCCTTTTTTTTTTCAAAG
TCACGTGGCGATTTTACGCCTGCGCCTCTACACGCAATTAAGGGGATTCTCTGCTGCAAG
CACAAGCTAGCTTCTTCTGCTGACGTACAGTAGAAACATTGCTAGAGTTCTCTCTGTCTT
GTTCCTTTCCATTCAAAAGTACACTAGGATATCAGAGTCACACAGAGCAGTCACTGTATG
TACCATTTTTGGGCGGTGCTTTGTGCTTCCCTGTACAAAATCTGAAAGAGAAAGATTGTA
CTAGGCAGAAAGCCGACCTACCAATACCATAGTAAAGTTTAAATTCTTGTGGTCGCTC

CDS

576 bp

>Os01t0955000-03 Similar to phosphoesterase family protein.
ATGGCGGTTCGCCGCCGGCGACCCGGCCCCGTGGCGGCCGCCGTGCTGCTGCTACTCGCG
GTGGCGACCCAGGCGGCGGCGAGCccgataaagacggtggtggtggtggtgatggagaac
cggtcgttcgaccacatgctGGGGTGGATGAAGCGGCTGAACCCGGAGATCGACGGCGTG
ACCGGCGGCGAGTGGAACCCGACGAACGCCAGCGACCCGTCGTCGGGGCGCGTCTACTTC
GGCGAGGGCGCCGAGTACGTGGACCCAGACCCGGGCCACTCGTTCCAGGAGATCCGGCAG
CAGATATTCGGGTCGGACGACGCGTCGGGGCCGGCGAGGATGGACGGCTTCGTGCAGCAG
GCGCGGTCGCTGGGGGACAACATGACGGCGGCCGTCATGAACGGCTTCTCGCCGGACAGC
GTCGCCGTGTACCGGGAGCTCGTCGGGGAGTTCGCGGTGTTCGACCGGTGGTTCGCGTCC
GTGCCGTCGTCGACGCAGCCCAACCGACTGTTCGTGCACTCCGCCACATCCGGCGGCGCC
ACCAGCAACAACCCAGAGTACGTGCATTATTATTAA

Protein

192 aa

>Os01t0955000-03 Similar to phosphoesterase family protein.
MAVRRRRPGPVAAAVLLLLAVATQAAASPIKTVVVVVMENRSFDHMLGWMKRLNPEIDGV
TGGEWNPTNASDPSSGRVYFGEGAEYVDPDPGHSFQEIRQQIFGSDDASGPARMDGFVQQ
ARSLGDNMTAAVMNGFSPDSVAVYRELVGEFAVFDRWFASVPSSTQPNRLFVHSATSGGA
TSNNPEYVHYY*

5'UTR

chr01:42067705..42067778 (- strand) : 74 bp

CDS

chr01:42067129..42067704 (- strand) : 576 bp

3'UTR

chr01:42066281..42067128 (- strand) : 848 bp

FASTA

>Os01t0955000-03 class=Sequence position=chr01:42066281..42067778 (- strand)
ATCACGAGCT CCCCTCCCCA CACACCACCT CACTCCCACT ACGAGAGAGG AGGAAGCTCG CAATCATCGA ATCAATGGCG
GTTCGCCGCC GGCGACCCGG CCCCGTGGCG GCCGCCGTGC TGCTGCTACT CGCGGTGGCG ACCCAGGCGG CGGCGAGCcc
gataaagacg gtggtggtgg tggtgatgga gaaccggtcg ttcgaccaca tgctGGGGTG GATGAAGCGG CTGAACCCGG
AGATCGACGG CGTGACCGGC GGCGAGTGGA ACCCGACGAA CGCCAGCGAC CCGTCGTCGG GGCGCGTCTA CTTCGGCGAG
GGCGCCGAGT ACGTGGACCC AGACCCGGGC CACTCGTTCC AGGAGATCCG GCAGCAGATA TTCGGGTCGG ACGACGCGTC
GGGGCCGGCG AGGATGGACG GCTTCGTGCA GCAGGCGCGG TCGCTGGGGG ACAACATGAC GGCGGCCGTC ATGAACGGCT
TCTCGCCGGA CAGCGTCGCC GTGTACCGGG AGCTCGTCGG GGAGTTCGCG GTGTTCGACC GGTGGTTCGC GTCCGTGCCG
TCGTCGACGC AGCCCAACCG ACTGTTCGTG CACTCCGCCA CATCCGGCGG CGCCACCAGC AACAACCCAG AGTACGTGCA
TTATTATTAA CCTTCTCCTA CTATTTCCGC GTGATATCGC TTTTGATGAT TCGATATCTA TCTTTGGGCT GGCCGCGACA
AATGCGTTCT GATTCGATCG ATATATCGTT TGCGTGTGGA CGTACGTGAT CGAATTCCAA CCATCGTAGT ATAGTTATTT
CAATCTGCTG GGTTTGGTGG CCAAAATTAT TGATGATGGA TCAATGGTGT TCAGACTCGA GATGAGCTGT TGTTGCACTT
GCACACTAGG ATACGCACAA ACTAAATGCG GCCGTAGTAG TTAAAAGAGT TGCATTTTGA ACCAAACAGA TGCCATCTTT
TGCTTAATCT GTTCAATTTT GGATAGTGGT GATAGTTATT TTTCCTTTTA GCCATAGTAC TGATAGTTCT GCTAGCATAA
TTAACCTTGT AGAATCTGAA CTGCGGTTGT ACGTACAATA TACTGTGGGT AGTATCTGAA TTTTGAAATA TATATACTGC
GGGTAGTATC TGAAGTACTC ACTAAGTTCA GGTATCAGTT GTCAACTAGC GGTCAAATTG CACCCTTTTT TTTTTCAAAG
TCACGTGGCG ATTTTACGCC TGCGCCTCTA CACGCAATTA AGGGGATTCT CTGCTGCAAG CACAAGCTAG CTTCTTCTGC
TGACGTACAG TAGAAACATT GCTAGAGTTC TCTCTGTCTT GTTCCTTTCC ATTCAAAAGT ACACTAGGAT ATCAGAGTCA
CACAGAGCAG TCACTGTATG TACCATTTTT GGGCGGTGCT TTGTGCTTCC CTGTACAAAA TCTGAAAGAG AAAGATTGTA
CTAGGCAGAA AGCCGACCTA CCAATACCAT AGTAAAGTTT AAATTCTTGT GGTCGCTC

Locus: Os01g0955000

Loading...

Locus: Os01g0955000

Loading...