Os01t0955100-01

Locus

Os01g0955100

Description

Calmodulin-like protein, Drought and salt tolerance

RAP-DB Gene Symbol Synonym(s)

OsMSR2

RAP-DB Gene Name Synonym(s)

Multi-Stress-Responsive gene 2

CGSNL Gene Symbol

CML31

CGSNL Gene Name

CALMODULIN-LIKE PROTEIN 31

Oryzabase Gene Symbol Synonym(s)

OsCML31, OsMSR2, MSR2

Oryzabase Gene Name Synonym(s)

calmodulin-like protein 31, multi-stress-responsive gene 2

Transcript Evidence

AK062671

Protein Evidence

Q8RYK0

Literature

PMID: 21359958

Note

Manual Curation

September 15, 2020

Gene Ontology (GO)

Molecular Function: calcium ion binding (GO:0005509)

Functional domain (InterPro)

EF-hand domain pair (IPR011992)

EF-hand domain (IPR002048)

EF-Hand 1, calcium-binding site (IPR018247)

Experimentally confirmed subcellular location

cytoplasm (GO:0005737)

Full-length cDNA

001-105-G04 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0955100-01)

Others

Oryzabase (10515)

Transcript

675 bp

>Os01t0955100-01 Calmodulin-like protein, Drought and salt tolerance
CGATATATCGATCGACAATGGTTGTTGCATCAGCAGCATCGCCGTGCGAGTCCAGTGCGT
TGTTCGCGACGTTCGACCACGACGGCGACGGCAGGATCTCCGCGGCGGAGCTGCGGCTGT
GCATGAAGACGACGCTCGGGGAGGAGGTGTCGGACGAGGAGgcggggcagctggtggcgt
cggtggacgcggacggcgacgggctgctgtgcgaggcggagttcgtgcggctggtgcagg
cggcggaggtggaggaggaagacgagcggcggggcaccggcctccgggaggcgttcggca
tgtacgagatggaaggggaaggGTGCATCACGCCGACGAGCCTCAGGCGGATGCTGCGCC
GGCTGGGCTCCGACCAGGACATCGACGACTGCCGCGCCATGATCTGCAGGTTCGATCTCA
ACGGCGACGGCGTCCTCAGCTTCGACGAGTTCAAGATCATGATGAACGCCTAAACCAGCT
GCTATCTGCTGATCCCTCCGCTAGCTCCATCAGAGCGCGCGCATCCATCGATCTGCAGTA
CAAGTAGTGTTCTTGCAGCGTGTCGTGTATATACACATAGGTGCTGTAAATCATGCTCAG
TTCACTTGATTGGTTTAGGTGTTTATACATCATTCATTTCATTTGTTAATAATGGGATTT
ATACATAGTAAATTC

CDS

456 bp

>Os01t0955100-01 Calmodulin-like protein, Drought and salt tolerance
ATGGTTGTTGCATCAGCAGCATCGCCGTGCGAGTCCAGTGCGTTGTTCGCGACGTTCGAC
CACGACGGCGACGGCAGGATCTCCGCGGCGGAGCTGCGGCTGTGCATGAAGACGACGCTC
GGGGAGGAGGTGTCGGACGAGGAGgcggggcagctggtggcgtcggtggacgcggacggc
gacgggctgctgtgcgaggcggagttcgtgcggctggtgcaggcggcggaggtggaggag
gaagacgagcggcggggcaccggcctccgggaggcgttcggcatgtacgagatggaaggg
gaaggGTGCATCACGCCGACGAGCCTCAGGCGGATGCTGCGCCGGCTGGGCTCCGACCAG
GACATCGACGACTGCCGCGCCATGATCTGCAGGTTCGATCTCAACGGCGACGGCGTCCTC
AGCTTCGACGAGTTCAAGATCATGATGAACGCCTAA

Protein

152 aa

>Os01t0955100-01 Calmodulin-like protein, Drought and salt tolerance
MVVASAASPCESSALFATFDHDGDGRISAAELRLCMKTTLGEEVSDEEAGQLVASVDADG
DGLLCEAEFVRLVQAAEVEEEDERRGTGLREAFGMYEMEGEGCITPTSLRRMLRRLGSDQ
DIDDCRAMICRFDLNGDGVLSFDEFKIMMNA*

5'UTR

chr01:42074850..42074866 (- strand) : 17 bp

CDS

chr01:42074394..42074849 (- strand) : 456 bp

3'UTR

chr01:42074192..42074393 (- strand) : 202 bp

FASTA

>Os01t0955100-01 class=Sequence position=chr01:42074192..42074866 (- strand)
CGATATATCG ATCGACAATG GTTGTTGCAT CAGCAGCATC GCCGTGCGAG TCCAGTGCGT TGTTCGCGAC GTTCGACCAC
GACGGCGACG GCAGGATCTC CGCGGCGGAG CTGCGGCTGT GCATGAAGAC GACGCTCGGG GAGGAGGTGT CGGACGAGGA
Ggcggggcag ctggtggcgt cggtggacgc ggacggcgac gggctgctgt gcgaggcgga gttcgtgcgg ctggtgcagg
cggcggaggt ggaggaggaa gacgagcggc ggggcaccgg cctccgggag gcgttcggca tgtacgagat ggaaggggaa
ggGTGCATCA CGCCGACGAG CCTCAGGCGG ATGCTGCGCC GGCTGGGCTC CGACCAGGAC ATCGACGACT GCCGCGCCAT
GATCTGCAGG TTCGATCTCA ACGGCGACGG CGTCCTCAGC TTCGACGAGT TCAAGATCAT GATGAACGCC TAAACCAGCT
GCTATCTGCT GATCCCTCCG CTAGCTCCAT CAGAGCGCGC GCATCCATCG ATCTGCAGTA CAAGTAGTGT TCTTGCAGCG
TGTCGTGTAT ATACACATAG GTGCTGTAAA TCATGCTCAG TTCACTTGAT TGGTTTAGGT GTTTATACAT CATTCATTTC
ATTTGTTAAT AATGGGATTT ATACATAGTA AATTC

Locus: Os01g0955100

Loading...

Locus: Os01g0955100

Loading...