Os01t0961200-01

Locus

Os01g0961200

Description

Cystathionine beta-synthase, core domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsCBSCBSPB3

Oryzabase Gene Name Synonym(s)

cystathionine b-synthase domain containing protein OsCBSCBSPB3, CBS domain containing protein OsCBSCBSPB3

Transcript Evidence

AK105424 (DDBJ, Best hit)

Protein Evidence

NP_001148069.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: metabolic process (GO:0008152)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

Phox/Bem1p (IPR000270)

Cystathionine beta-synthase, core (IPR000644)

Aldolase-type TIM barrel (IPR013785)

Full-length cDNA

001-124-C05 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0961200-01)

RiceXPro (AK105424)

Others

Oryzabase (10353)

KEGG (Os01t0961200-01)

Transcript

2029 bp

>Os01t0961200-01 Cystathionine beta-synthase, core domain containing protein.
GCAGCTTGCCTTGGACTCCACCATTTCAAATCCCCTgcctcctccgcctccgcttccccc
ctcaccttctccggcgatcgccgccgcgtccgtacacggctgaggcctgaggcgatggcc
gccgccgccgcctcccagcctcgcagccaccagcccacctcgctccgccgcgcgccgcca
ccttcttcggccgcggccaagccagagcccaatgagaaggcctccaactccaagcccgcc
tcgcccgtccaggcaccGTCGCCGGAGAGGACGGTGAAGAAGCTGAGGTTGGCCAAGGCG
CTCACGCTTCCGGAGGCCACCTCGGTGTCGGAGGCGTGCCGGAGGATGGCGCTCAAGCGA
GTGGATGCCGCGTTGCTCACTGATTCCAACGGGATGCTCTCCGGCATACTCACAGCAGAG
GACATATCAGGACGGGTGATAGCAGAGGGACTCAGGCCTGACGAAACAAATGTGGCCAAA
GCGATGACGCGTAACCCAGTTTTTGTTATGTCCAACTCACCAGCCATTGAAGCATTACAA
AAGATGGTCAAAGGAAAGTTCAGACATCTTCCTGTAGTGGAACACGGTGAGgtaattgcc
atgctggacattaccaagttcctttatgatgcaatttcaagaatggaaaaggctgcagaa
caaggcagtgcaatagcagctgctatggAAGGAGTTGAACGACAGTGGGGAAATGACTTT
CCAGGTCCACATTCATTTATCGAAAATCTGCGAGACCAGCTGTTCAAGCCTTCCTTATCA
ACCATCATAACAGAAAATAACAGTGTTCCAGTAGTATCTCCTTCAGATCCTGTAATAGCA
GCTGCCAAAAAAATGAGAGAATACCGAGTCAACTCAGTGGTTGTCATGACAGGGAACATG
TTGCTAGGAATTCTTACTTCCAAGGATTTGGTATTGCGATTAGTGGCCCAAAGTTTATCC
CCAGATGTGACTCTTGTAGAAAAGGTTATGACTACAAACCCTGATTGTGCGACATTGGAT
ACATCGATCCTTGAGGCCCTGCATTCAATGCAAGACGGGAAATATCTGCATATTCCTGTT
GCCGACAAAAATGGACAGATCATCGCATGTTTGGATGCTCTACAATTAACCCATGCAGCT
ATTTCAATGGTTGAGGGAGCTTCTGAAGCGAACAGTATGGCAAATACTATGATGCAGAAG
TTCTGGGATTCAGCTCTTGCCCTGCAGCCTGCAGAGGAATCGGATGCCCGTAGTGAAGAA
TCTCGAATGGCAACATCAGATAATGCTGAAGGGAAACATATACCCCCTCATGTTGGCAAT
TCATTCTCCTTTAAACTACAAGATAGAAAAGGGCGTATGCACAGATTCAGTTGTGTTTCA
GAAAGCTTAGATGAGCTTGTTTCTGCCGTATCGTACAGACTGGGAATGGAAAAAGAGAAG
ATTAATCTTCTGTATGATGACGATGAAGGTGACAGGGTGGTTCTGACCACCGACGGTGAC
CTCAGTGCGGCAATTCAGCATGCGAGATCAGCTGGATGGAAGGTTCTGAGGCTGCATATG
GATGAGCCCTGGAGCAATGGGGAGCACACCACATCGCTTGTAAATACTTCACCGGTGAAA
ACAGGGCGGTCATTTCTCCGGCTAGGCATCGCAGCTGGTGCAGTTGCGGTTGCCAGCATG
GGGGTAATCTTCTACTTGAAACGTTCTGAACTATAATTAATTCCCACACATACATCAACA
CATCAACATTGTAAAGATTACTTCTTCTCCGGAAGGTGAGATGTGTTGTATACGTAGGAG
ACAAACACGTCAAACATCAGCAATAAGGCGTGGACTATGGTTAGAAAGAATTTCCACGTG
CTAAAGCTTGTAAGATTGGATGGTGTTTCATTCAATTTTAGATTGGTTTATTTTGAGACA
GATGGAGCAAAGATTTTTTTGAGGTTTTTTTTCTTGAGTTTTCTTGTTTCAGCCTTCCTA
CCCTTTTTGCAACCTTGTGTGATATAAATAAGGGATTCAACCAGCTTGG

CDS

1602 bp

>Os01t0961200-01 Cystathionine beta-synthase, core domain containing protein.
atggccgccgccgccgcctcccagcctcgcagccaccagcccacctcgctccgccgcgcg
ccgccaccttcttcggccgcggccaagccagagcccaatgagaaggcctccaactccaag
cccgcctcgcccgtccaggcaccGTCGCCGGAGAGGACGGTGAAGAAGCTGAGGTTGGCC
AAGGCGCTCACGCTTCCGGAGGCCACCTCGGTGTCGGAGGCGTGCCGGAGGATGGCGCTC
AAGCGAGTGGATGCCGCGTTGCTCACTGATTCCAACGGGATGCTCTCCGGCATACTCACA
GCAGAGGACATATCAGGACGGGTGATAGCAGAGGGACTCAGGCCTGACGAAACAAATGTG
GCCAAAGCGATGACGCGTAACCCAGTTTTTGTTATGTCCAACTCACCAGCCATTGAAGCA
TTACAAAAGATGGTCAAAGGAAAGTTCAGACATCTTCCTGTAGTGGAACACGGTGAGgta
attgccatgctggacattaccaagttcctttatgatgcaatttcaagaatggaaaaggct
gcagaacaaggcagtgcaatagcagctgctatggAAGGAGTTGAACGACAGTGGGGAAAT
GACTTTCCAGGTCCACATTCATTTATCGAAAATCTGCGAGACCAGCTGTTCAAGCCTTCC
TTATCAACCATCATAACAGAAAATAACAGTGTTCCAGTAGTATCTCCTTCAGATCCTGTA
ATAGCAGCTGCCAAAAAAATGAGAGAATACCGAGTCAACTCAGTGGTTGTCATGACAGGG
AACATGTTGCTAGGAATTCTTACTTCCAAGGATTTGGTATTGCGATTAGTGGCCCAAAGT
TTATCCCCAGATGTGACTCTTGTAGAAAAGGTTATGACTACAAACCCTGATTGTGCGACA
TTGGATACATCGATCCTTGAGGCCCTGCATTCAATGCAAGACGGGAAATATCTGCATATT
CCTGTTGCCGACAAAAATGGACAGATCATCGCATGTTTGGATGCTCTACAATTAACCCAT
GCAGCTATTTCAATGGTTGAGGGAGCTTCTGAAGCGAACAGTATGGCAAATACTATGATG
CAGAAGTTCTGGGATTCAGCTCTTGCCCTGCAGCCTGCAGAGGAATCGGATGCCCGTAGT
GAAGAATCTCGAATGGCAACATCAGATAATGCTGAAGGGAAACATATACCCCCTCATGTT
GGCAATTCATTCTCCTTTAAACTACAAGATAGAAAAGGGCGTATGCACAGATTCAGTTGT
GTTTCAGAAAGCTTAGATGAGCTTGTTTCTGCCGTATCGTACAGACTGGGAATGGAAAAA
GAGAAGATTAATCTTCTGTATGATGACGATGAAGGTGACAGGGTGGTTCTGACCACCGAC
GGTGACCTCAGTGCGGCAATTCAGCATGCGAGATCAGCTGGATGGAAGGTTCTGAGGCTG
CATATGGATGAGCCCTGGAGCAATGGGGAGCACACCACATCGCTTGTAAATACTTCACCG
GTGAAAACAGGGCGGTCATTTCTCCGGCTAGGCATCGCAGCTGGTGCAGTTGCGGTTGCC
AGCATGGGGGTAATCTTCTACTTGAAACGTTCTGAACTATAA

Protein

534 aa

>Os01t0961200-01 Cystathionine beta-synthase, core domain containing protein.
MAAAAASQPRSHQPTSLRRAPPPSSAAAKPEPNEKASNSKPASPVQAPSPERTVKKLRLA
KALTLPEATSVSEACRRMALKRVDAALLTDSNGMLSGILTAEDISGRVIAEGLRPDETNV
AKAMTRNPVFVMSNSPAIEALQKMVKGKFRHLPVVEHGEVIAMLDITKFLYDAISRMEKA
AEQGSAIAAAMEGVERQWGNDFPGPHSFIENLRDQLFKPSLSTIITENNSVPVVSPSDPV
IAAAKKMREYRVNSVVVMTGNMLLGILTSKDLVLRLVAQSLSPDVTLVEKVMTTNPDCAT
LDTSILEALHSMQDGKYLHIPVADKNGQIIACLDALQLTHAAISMVEGASEANSMANTMM
QKFWDSALALQPAEESDARSEESRMATSDNAEGKHIPPHVGNSFSFKLQDRKGRMHRFSC
VSESLDELVSAVSYRLGMEKEKINLLYDDDEGDRVVLTTDGDLSAAIQHARSAGWKVLRL
HMDEPWSNGEHTTSLVNTSPVKTGRSFLRLGIAAGAVAVASMGVIFYLKRSEL*

5'UTR

chr01:42377194..42377307 (+ strand) : 114 bp

CDS

chr01:42377308..42377450 (+ strand) : 143 bp

chr01:42377588..42377750 (+ strand) : 163 bp

chr01:42378095..42378227 (+ strand) : 133 bp

chr01:42378565..42378735 (+ strand) : 171 bp

chr01:42378853..42378931 (+ strand) : 79 bp

chr01:42379010..42379123 (+ strand) : 114 bp

chr01:42379262..42379328 (+ strand) : 67 bp

chr01:42379434..42379539 (+ strand) : 106 bp

chr01:42379609..42379667 (+ strand) : 59 bp

chr01:42379873..42379976 (+ strand) : 104 bp

chr01:42380066..42380187 (+ strand) : 122 bp

chr01:42380285..42380361 (+ strand) : 77 bp

chr01:42380846..42380935 (+ strand) : 90 bp

chr01:42381033..42381206 (+ strand) : 174 bp

3'UTR

chr01:42381207..42381519 (+ strand) : 313 bp

FASTA

>Os01t0961200-01 class=Sequence position=chr01:42377194..42381519 (+ strand)
GCAGCTTGCC TTGGACTCCA CCATTTCAAA TCCCCTgcct cctccgcctc cgcttccccc ctcaccttct ccggcgatcg
ccgccgcgtc cgtacacggc tgaggcctga ggcgatggcc gccgccgccg cctcccagcc tcgcagccac cagcccacct
cgctccgccg cgcgccgcca ccttcttcgg ccgcggccaa gccagagccc aatgagaagg cctccaactc caagcccgcc
tcgcccgtcc aggcaccgta agcgccgccg cccctcccct cgcgatcgcG ATGGCTTCCG CCGCAAGGAA GGGCGTTCCT
GGCTCCTACC TACCTTCGCC CCGTGCTGAT TCATTTGGAG CTTGCGTTTT TGTGCTTGTT AATTTGGCGC GCAGGTCGCC
GGAGAGGACG GTGAAGAAGC TGAGGTTGGC CAAGGCGCTC ACGCTTCCGG AGGCCACCTC GGTGTCGGAG GCGTGCCGGA
GGATGGCGCT CAAGCGAGTG GATGCCGCGT TGCTCACTGA TTCCAACGGG ATGCTCTCCG GCATACTCAC AGCAGAGGTC
TGAATCACTT ATTTGCCTGC CTTGTCGTCG TGAACTGATC AATGCCAAAT GCAATTTATT TTGTGTTCAA TCAGTTTTGA
GTTACAGAGA AATTCATCAG TCATTCAGAT TTAGCGGTGA CGATTATGCA ACCTGAGCTT GATTGGGTAC TGTAGCTCAT
TGTCATGTCA CATGAGACAA ATTAGATTTT ATTTTCAGGG ATATTGGGCT TTAAGACTTG ATAACATAAA ACGGATAAGT
TTTGAAGGTT TTACTGTAGA ACAAGATGTG CTTAACATTT TAATGCTGTT AATGATGACG ATCAAGTTTA CGGAAGGATT
TTTTGTATTT TTGTTTTGTA GGACATATCA GGACGGGTGA TAGCAGAGGG ACTCAGGCCT GACGAAACAA ATGTGGCCAA
AGCGATGACG CGTAACCCAG TTTTTGTTAT GTCCAACTCA CCAGCCATTG AAGCATTACA AAAGATGGTC AAAGGTATTG
ATACCATTTT TGCTTCTCAA CATCATCATT TGTTCTTCGC TTTACTGTTG TTTATGGAGT ATAATTTACT TTTTTCTTAT
CAAATACGGC CTATGAACCA TGTTGAAACT CAGGCACTCA GCAGCTATAT AGGCTAAGGG ATCATATGTC TGATAAAAAT
GTTTCTTGCA AAATTACAAA TGTTAGGCTC TTTTGGGAGA AAGTAAGATT CTTTTTTTCC TGATAATTGC AAAGTTAGAT
AGATTCTTTC TTATGTTCTT CTGAGTGAAT TATTTTCCTT TTCTTTTTGG GTCTGAATGC TCTCTTGTGG CAACATGGCA
TTCATTAACA GGAAAGTTCA GACATCTTCC TGTAGTGGAA CACGGTGAGg taattgccat gctggacatt accaagttcc
tttatgatgc aatttcaaga atggaaaagg ctgcagaaca aggcagtgca atagcagctg ctatggAAGG AGTTGAACGA
CAGTGGGGAA ATGACTTTCC AGGTTAATTT GTTTTAGTTT TATTTGAATA TGGTATTATC TATTTTCTAC ATAACAATCA
TGGTGCATTC CACTCAATTT TCTTTTGATT AAACGATGTT ACACTTTGGG CTACTTCAGG TCCACATTCA TTTATCGAAA
ATCTGCGAGA CCAGCTGTTC AAGCCTTCCT TATCAACCAT CATAACAGAA AATAACAGGT ACTAGTTCTA TATTCCCAGG
AAGACTTATG TTTTGAACTA TTTCTCATTG AATTTTCACA CCGCTCTTTT TTCTAGTGTT CCAGTAGTAT CTCCTTCAGA
TCCTGTAATA GCAGCTGCCA AAAAAATGAG AGAATACCGA GTCAACTCAG TGGTTGTCAT GACAGGGAAC ATGTTGCTAG
GAATTCTTAC GTATGTTTTT CTTTACATAA AACTTCTTTT TCTTAACACA GTTATCTGCT CAATGGTAAC ACTAGGATAG
TGTAGACTGC TTTCTATGAT ATAATTCTAT TTAAGTGATT AATGGAATCT GTGCTGGATA TACTGTAGTT CCAAGGATTT
GGTATTGCGA TTAGTGGCCC AAAGTTTATC CCCAGATGTG ACTCTTGTAG AAAAGGTACC TTTACAAAGT TGAAACCTCT
GCATTTTAAA TCATGTTGCT TTCATGTCTT ATTTTTATTA TTTTCACAAT TTGATTCAAT ATGCTGGTAC ATTTCTGAAG
GTTATGACTA CAAACCCTGA TTGTGCGACA TTGGATACAT CGATCCTTGA GGCCCTGCAT TCAATGCAAG ACGGGAAATA
TCTGCATATT CCTGTTGCCG ACAAAAGCAA GTACCGAATT CTAACAACAG GGAAATCTTT TTTCGATGTG CATATCTAAC
TTAACTTTTG AATAGATGGA CAGATCATCG CATGTTTGGA TGCTCTACAA TTAACCCATG CAGCTATTTC AATGGTAGGG
GACAGTTTTG TTTTCGTTAC CAGATCATGC CAGTGTACAT TTTTTTTCGG TGTTCCATCA TGCTAAGAAA ACAGTATTTT
TCCGGCAAGA TAAATGATCC ATTCTGAATG AAAAGAAGTA ACACTTTAGT CCCTGTGGCT GCATTTATTT TTAGTACTTT
GGAGTTTGGA TGTACTAAAG GTCACTTTGT TTGTGTTAGG TTGAGGGAGC TTCTGAAGCG AACAGTATGG CAAATACTAT
GATGCAGAAG TTCTGGGATT CAGCTCTTGC CCTGCAGCCT GCAGAGGAAT CGGATGCCCG TAGGTTTGTT CTTTTCTTTT
TTTACTTGCT TAGTTGAATA GTTTGCGATT CATTTTCAAT AGCCTCATGG TTAGTCTTCT GTTATAGCGC AGTGAAGAAT
CTCGAATGGC AACATCAGAT AATGCTGAAG GGAAACATAT ACCCCCTCAT GTTGGCAATT CATTCTCCTT TAAACTACAA
GATAGAAAAG GGCGTATGCA CAGATTCAGT TGTGGTTGGT CTATTCTCAT CGTTATTTCC TGATTGCAGT TTGTTGATAC
AGTAGTATAA AATTATGATT TTCTACTTGA TTGCGCCCTT CCTTTATACA GTTTCAGAAA GCTTAGATGA GCTTGTTTCT
GCCGTATCGT ACAGACTGGG AATGGAAAAA GAGAAGATTA ATCTTCTGGT AAGAGCAGAA CTGCGTTGTA CTTATACACG
CGATTTAGGT ACAGTAATAT GTAGTGCTTA AGATATACAA GATCGAACAT GTTAAAACCA AGCCCATTCT GTTTTGTTGA
TTGGCACTTC ATTTTCCCTG TTCATTCAGA ATATATTTTT CAGTAGTTTT AAAGGAAACT TTTACTACAA AACGGCTTTT
AAACCGAGCT TGTTTATGCA ATGTTACTCC AAGTGAACAA GAAGCCAAGC AAGCATGTGG TTGGAATCTG TTTATCGGAC
CTCTCTAGCT TTTACATCTT ACCGTCTTGG AATCTGAATC ttagcccttg tttagttccc aactttttct tcaaactttc
aacttttcca tcacatcaaa acttttctac atacataagc tttcaacatt ttccttcaaa ctttcaattt tagtcaaact
tacaattttg acgtggaact aaacacaccc ttaCTTGAAT CGCATTGAGC AGTATGATGA CGATGAAGGT GACAGGGTGG
TTCTGACCAC CGACGGTGAC CTCAGTGCGG CAATTCAGCA TGCGAGATCA GCTGGATGGA AGGTCACAAC TGAGCATTCC
TTTATTAGTT TGTTACTGTT CTTGCAGCCT CCTAGCTGCG GCATTCCGCT AATTTTTGGA GGTTGTTTTT CCTGTTCAGG
TTCTGAGGCT GCATATGGAT GAGCCCTGGA GCAATGGGGA GCACACCACA TCGCTTGTAA ATACTTCACC GGTGAAAACA
GGGCGGTCAT TTCTCCGGCT AGGCATCGCA GCTGGTGCAG TTGCGGTTGC CAGCATGGGG GTAATCTTCT ACTTGAAACG
TTCTGAACTA TAATTAATTC CCACACATAC ATCAACACAT CAACATTGTA AAGATTACTT CTTCTCCGGA AGGTGAGATG
TGTTGTATAC GTAGGAGACA AACACGTCAA ACATCAGCAA TAAGGCGTGG ACTATGGTTA GAAAGAATTT CCACGTGCTA
AAGCTTGTAA GATTGGATGG TGTTTCATTC AATTTTAGAT TGGTTTATTT TGAGACAGAT GGAGCAAAGA TTTTTTTGAG
GTTTTTTTTC TTGAGTTTTC TTGTTTCAGC CTTCCTACCC TTTTTGCAAC CTTGTGTGAT ATAAATAAGG GATTCAACCA
GCTTGG

Locus: Os01g0961200

Loading...

Locus: Os01g0961200

Loading...