Os01t0965400-01

Locus

Os01g0965400

Description

Chloroplast-targeted UMP kinase, Regulation of leaf colour

RAP-DB Gene Symbol Synonym(s)

YGL8

RAP-DB Gene Name Synonym(s)

yellow-green leaf 8

CGSNL Gene Symbol

YGL8

CGSNL Gene Name

YELLOW-GREEN LEAF 8

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

yellow green leaf 8

Transcript Evidence

AK069647

AK104789

Protein Evidence

Q5JJV9

Literature

PMID: 27297403

Note

Manual Curation

June 16, 2016

Gene Ontology (GO)

Biological Process: pyrimidine nucleotide biosynthetic process (GO:0006221)

Molecular Function: uridylate kinase activity (GO:0009041)

Molecular Function: UMP kinase activity (GO:0033862)

Cellular Component: cytoplasm (GO:0005737)

Functional domain (InterPro)

Uridylate kinase (IPR011817)

Uridylate kinase, bacteria (IPR015963)

Aspartate/glutamate/uridylate kinase (IPR001048)

Full-length cDNA

J023027E20 (Online Clone Ordering)

001-039-E08 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0965400-01)

Others

Oryzabase (22137)

Transcript

1383 bp

>Os01t0965400-01 Chloroplast-targeted UMP kinase, Regulation of leaf colour
ATCGTCATCATCTCGTCCCCCCTCTTCCCGGCGCGGCGGTTGCTCTCCAGCCATGGCCGC
CGCCGCCGCCGCCGCCGTCGCCTGCGGCATGTCTACGTCCTTCCTCATCCGCCTCTCGCC
TTCGCCGCCGGCGTCTTCCCACGTGCCTCTCCCTCGGTCTCCGGCTTCGTCGGCGCGCCC
GCGGCGAGCGTCTTCCGTCTCCCTCTCCACCGCGCCTAGGCCGAGGGCACGCGCCGCCGG
CTCCGACTCTCCCTCCAACTTTGGAGGTCAAACATCACTGATGCCACCATTCAGCCTTAT
GCTTGATGAAGGCTCTAGATCTAAAAAGCCATATAGATGGCAAAGGGTGTTGCTTAAAGT
AAGTGGGGAGGCTCTTGCTGGAGATCACACAGAAAATATTGATCCAAAGATCACGATGGC
AATTGCAAGAGAGGTTGCTTCTGTCACCAGACTAGGTGTAGAGGTTGCTATTGTTGTTGG
TGGCGGCAATATCTTCCGCGGGGCCTCTTGGGCTGGATGTAGTGGACTCGACCGCTCATC
AGCAGATTACATTGGCATGTTGGCTACTGTGATGAATGCCATATTTCTTCAAGCAACAAT
GGAGAGCATTGGAATACCAACCCGTGTCCAAACTGCATTTCGTATGTCAGAAGTTGCAGA
ACCATACATACGCCGAAGAGCTGTCAGGCATTTAGAGAAAGGAAGAGTTGTTATATTTGC
TGCTGGTACAGGGAACCCATTCTTTACAACTGATACAGCTGCTGCTCTTCGTTGTGCAGA
AATCAATGCAGAGGTAGTACTTAAGGCAACAAATGTTGACGGTGTGTACGACGCAGACCC
CAAGCGTAACCCAAATGCCCGCCTTCTTGAGGCTGTGAGCTACCATGAGGTGCAAACAAG
AGACCTCTCAGTAATGGACATGACTGCCATTACGCTATGCCAAGAAAACAACATTCCTGT
TGTCGTGTTTAATTTGCAAAAACCTGGAAATATTGCGAAAGCTATTGTTGGTGAGAAGGT
TGGCACGTTTATAGGCTGCACAAAAGATCAGGACCAGATTGTGGGGAATGCACTGGATCA
AGAAAGAAGATTGGTGAACGAGTTATGATTTCACTGGAGCTCTCTGTCGCTAGCTGTGTA
GCTGCATTGCCTATTGCTTGGTAACATGTGGATCTCTAGAGTTTTTAGGCTAGAATAGCT
TATCCAAATCCTGGTTCCTTGTACAACCTTTGAGCAAAAATAAAAAAACCAATGGTAACA
GAGATTTTCCAGCTGATATAGCTGCTATGTTGTCATACTATGTACAATGGAATCTAGAGC
AATCTGATAAATCACATTTATATCTTAAAATCATTGCATGTGGCATGTATGATGTCTTCA
CCT

CDS

1056 bp

>Os01t0965400-01 Chloroplast-targeted UMP kinase, Regulation of leaf colour
ATGGCCGCCGCCGCCGCCGCCGCCGTCGCCTGCGGCATGTCTACGTCCTTCCTCATCCGC
CTCTCGCCTTCGCCGCCGGCGTCTTCCCACGTGCCTCTCCCTCGGTCTCCGGCTTCGTCG
GCGCGCCCGCGGCGAGCGTCTTCCGTCTCCCTCTCCACCGCGCCTAGGCCGAGGGCACGC
GCCGCCGGCTCCGACTCTCCCTCCAACTTTGGAGGTCAAACATCACTGATGCCACCATTC
AGCCTTATGCTTGATGAAGGCTCTAGATCTAAAAAGCCATATAGATGGCAAAGGGTGTTG
CTTAAAGTAAGTGGGGAGGCTCTTGCTGGAGATCACACAGAAAATATTGATCCAAAGATC
ACGATGGCAATTGCAAGAGAGGTTGCTTCTGTCACCAGACTAGGTGTAGAGGTTGCTATT
GTTGTTGGTGGCGGCAATATCTTCCGCGGGGCCTCTTGGGCTGGATGTAGTGGACTCGAC
CGCTCATCAGCAGATTACATTGGCATGTTGGCTACTGTGATGAATGCCATATTTCTTCAA
GCAACAATGGAGAGCATTGGAATACCAACCCGTGTCCAAACTGCATTTCGTATGTCAGAA
GTTGCAGAACCATACATACGCCGAAGAGCTGTCAGGCATTTAGAGAAAGGAAGAGTTGTT
ATATTTGCTGCTGGTACAGGGAACCCATTCTTTACAACTGATACAGCTGCTGCTCTTCGT
TGTGCAGAAATCAATGCAGAGGTAGTACTTAAGGCAACAAATGTTGACGGTGTGTACGAC
GCAGACCCCAAGCGTAACCCAAATGCCCGCCTTCTTGAGGCTGTGAGCTACCATGAGGTG
CAAACAAGAGACCTCTCAGTAATGGACATGACTGCCATTACGCTATGCCAAGAAAACAAC
ATTCCTGTTGTCGTGTTTAATTTGCAAAAACCTGGAAATATTGCGAAAGCTATTGTTGGT
GAGAAGGTTGGCACGTTTATAGGCTGCACAAAAGATCAGGACCAGATTGTGGGGAATGCA
CTGGATCAAGAAAGAAGATTGGTGAACGAGTTATGA

Protein

352 aa

>Os01t0965400-01 Chloroplast-targeted UMP kinase, Regulation of leaf colour
MAAAAAAAVACGMSTSFLIRLSPSPPASSHVPLPRSPASSARPRRASSVSLSTAPRPRAR
AAGSDSPSNFGGQTSLMPPFSLMLDEGSRSKKPYRWQRVLLKVSGEALAGDHTENIDPKI
TMAIAREVASVTRLGVEVAIVVGGGNIFRGASWAGCSGLDRSSADYIGMLATVMNAIFLQ
ATMESIGIPTRVQTAFRMSEVAEPYIRRRAVRHLEKGRVVIFAAGTGNPFFTTDTAAALR
CAEINAEVVLKATNVDGVYDADPKRNPNARLLEAVSYHEVQTRDLSVMDMTAITLCQENN
IPVVVFNLQKPGNIAKAIVGEKVGTFIGCTKDQDQIVGNALDQERRLVNEL*

5'UTR

chr01:42562823..42562874 (+ strand) : 52 bp

CDS

chr01:42562875..42563086 (+ strand) : 212 bp

chr01:42564294..42564438 (+ strand) : 145 bp

chr01:42564527..42564580 (+ strand) : 54 bp

chr01:42564811..42564902 (+ strand) : 92 bp

chr01:42565472..42565698 (+ strand) : 227 bp

chr01:42566312..42566488 (+ strand) : 177 bp

chr01:42566570..42566718 (+ strand) : 149 bp

3'UTR

chr01:42566719..42566993 (+ strand) : 275 bp

FASTA

>Os01t0965400-01 class=Sequence position=chr01:42562823..42566993 (+ strand)
ATCGTCATCA TCTCGTCCCC CCTCTTCCCG GCGCGGCGGT TGCTCTCCAG CCATGGCCGC CGCCGCCGCC GCCGCCGTCG
CCTGCGGCAT GTCTACGTCC TTCCTCATCC GCCTCTCGCC TTCGCCGCCG GCGTCTTCCC ACGTGCCTCT CCCTCGGTCT
CCGGCTTCGT CGGCGCGCCC GCGGCGAGCG TCTTCCGTCT CCCTCTCCAC CGCGCCTAGG CCGAGGGCAC GCGCCGCCGG
CTCCGACTCT CCCTCCAACT TTGGGTACGT GATTCTGCAC TCGGTTGGCT CCACGGGGTG TTGTTCTTCG TGGCTGCGGT
TGACGTGATG TTTTGTGGTC TCCCCCATTG TGTTTGTGCC AATGCGTGGT AACAATGGCG GAGAACTCGT ATGTCTGCGA
GTAGCCCCCA GCTTTTGGCC GGCCGCCATC GCCCTGAGAC ATGGTCAGCG CGTGCGAGAT GCGAGATATG AGAAGGAGCA
GTGTCGACCA CCCGAGTCTT AGCCGAGCGG AGGCCGGAGG CCTGAAGCTT TGGGCGGCGA GTTGGCCACC GAGGTTCGTG
GCGGTGTGTG CGGCGGCCGT ACGGGGTGGC ACACCGGCGT GTGGAGGGGA GCGAAATACT GTAAGAAATA GAGGACGAGG
CATTTCCCCA AATATTGCGG TATTTGCTAG ATTAGTGTCT TGGAGTTGGA TGCTAAATTT TGGGTAGGAT ATGTTCAGAT
ATGTCAGAGA AATTACAATA GCGCTCTAGC AGAATCTGTA GACTAGTAGC ATGATTCCCC TTTTACAGTA TCACTATGGA
ATGGAAGAAT TTTCTGTTAA AATTTTACTT CTAAAATCTC AATCCAAGAA ATTTACATAG GAATTAGTCT TCAGTCTTTT
CTTAGTGTAG TTCCTATTGA TGTCCTATTA CTTTGTGATT TTTTTTCCTG CGCTGCGCGT TTAATGTTCA ATAAAATGAA
TTTTAATCTA TTGCCGATGC AATCTTGAAT GGCGTTGGCA CTCACCGCGC CTCATTTTCC ATACATCCTC TGCCAGCGAC
GACGCCGTGC CACACATCAC AAGGATTAGA GATTGTAATA GATAGTAAGG GTGTCACTAC TGAGTTAACA AGGATGAACT
AGTGGCTATT TAGCTGTTAA GTGGCCCAAC TAAGACAAAG ACACTATCAT CTCTGAAAAA AGCGGTGTAT TATATATGAG
CACCTTTAAA TACTATTGTG ATGTCTTCAA GTCAAACTTA AATTATTTGT GTGTGCAATA CATCTGCATG GTTCATGTTC
ACAAATACTA AACTATGACT GTGACTTTTC CTTATATTCT GTTGGAATTG GCAGCTTGCC ATCAAAATCT GAGGTCAATT
CTGTAACAAT GTATGTTCTT TCAAATTCTG TAGTAGTTTC TTTCTGATGT TGAATACAGT CTAATTATGG AGTGAGTTAT
TCCTGATAAC GCATCTCCTT TTATTTGACA GAGGTCAAAC ATCACTGATG CCACCATTCA GCCTTATGCT TGATGAAGGC
TCTAGATCTA AAAAGCCATA TAGATGGCAA AGGGTGTTGC TTAAAGTAAG TGGGGAGGCT CTTGCTGGAG ATCACACAGA
AAATATTGAT CCAAAGGTGA GGTTGCTTTT AGTGGAGCAT TATCAAATTT AAAATACTGA ATATTTGATG GAACAGGTCA
TGTAAGTGTG TAATGTTGTT GCAGATCACG ATGGCAATTG CAAGAGAGGT TGCTTCTGTC ACCAGACTAG GTGTAGAGGT
GTGCCAGTGC CTTTCATTCT TTTATTGCTT ATTTACCCGA TTAACTGTTT GAAGATTGAA ATTAAATCAA GTGAAACATA
ATTAGGCATG TACATAGTAG ACATTTAAAG TTCAACAACT AAACCGCCCT GTGTTCCAAC GAAGTGGTAT TATGCTATGT
GTATGTTCCT CTTGTCTTCT CTATTGTAGA AACATATGCT GTACATTAAA GATCGGGAAC CCTTGCAGGT TGCTATTGTT
GTTGGTGGCG GCAATATCTT CCGCGGGGCC TCTTGGGCTG GATGTAGTGG ACTCGACCGC TCATCAGCAG ATTACATTGG
GTATGATGTT CAGTTTTCTA ATGTCTTTCA TAATTGAACC ATCGTAACAT CCTGTGGTTG GCAATCGAGA ATGCATTAAA
TGAAGTGGAA GCGCCATGAG GGTTAACCTA ATAATGACAC AAGAACACCC AACTCGGCAT GCCTTAGTAG TTGCATGCAA
CCATGCAAAT ATGCTAATTT ATGTAATCCA TGCTAACTTT TTTTTTTGGC TATTTAAACA TCTATAATAC CACGCCTGAT
TGTGCCTATC GGCCCATCAC GTAGAACACA TCTAAATTTC ATAGAACAAA ATTCCATAAC AAATTTCCAA GCAGAATAGT
GTACTGAGTG TAAACTTATA GTTCGATTTT ACAAACCATA CAATCAATAA GTATATACTG TTCTCTGTAA GTGCAAACTT
ACATGTAAGT ATTTAACATA TGGTCTATAT CCTTTGCCCA TAACGTTTTT AAAAATGTTT TTTAGGTTTT GTTTTAAAAA
AAAGAAGACA TCATTCCTGT TATAAGTGAT TTCATAATTT CTCAGCATAA AATAGTTCAC CACTTTATCT TACTCTTTTC
CTAATTCAGC ATGTTGGCTA CTGTGATGAA TGCCATATTT CTTCAAGCAA CAATGGAGAG CATTGGAATA CCAACCCGTG
TCCAAACTGC ATTTCGTATG TCAGAAGTTG CAGAACCATA CATACGCCGA AGAGCTGTCA GGCATTTAGA GAAAGGAAGA
GTTGTTATAT TTGCTGCTGG TACAGGGAAC CCATTCTTTA CAACTGATAC AGCTGCTGCT CTTCGTTGTG CAGAAAGTGA
GTTTATCCTC CGTTTCTCAC TAATGAACTG GTGTAATTGT AATCATAAAA TCTCAACAAA AGTAGTATTG GAGATACGTG
AATACTTTTA TATTTTAAAG CCAAGTGCTT ATAAGCTGCA ATTTCATGTC GTATATTTAA CAATATATAG TACTGCAAAA
CATTCAAGGT ACTTTTGCGA GTTTGTCATT TATGTTAGTC ATCATGCCCC TGTCAGTTGC TGGTAATAGA ACTAGAGTTC
TACCCACAAT AGCTCGTAAT GTTAGTAGCC TCACCTCTGA GTTTATCCCA TGAATTCATG AAGACCCTTG TGCGCCCTAA
ATGGTTAAGC TAGACAGTTA GGCTAGACAA GGATCGATCA TTTATTTTCA ACCTTGCTTC CCAGAAACTA GAGACATGAT
GCAGAGATTG TTATACATGC CATGTTAGGG TGTGTTTAAC TATTCTATTT CACAAGAAAT CATTAGTCAC AGTTTCCATT
ATGCATGTAG AATCATTTTA TCATGAATTG AGTTTGAACT TGTCTTTCTA TAATGATTTC TCAAATAAAC ATCATTGTCT
CATTTTGTTT ATTCCATCTT ACAATGGCTT TTTTTCTTTC ATTTTGCAGT CAATGCAGAG GTAGTACTTA AGGCAACAAA
TGTTGACGGT GTGTACGACG CAGACCCCAA GCGTAACCCA AATGCCCGCC TTCTTGAGGC TGTGAGCTAC CATGAGGTGC
AAACAAGAGA CCTCTCAGTA ATGGACATGA CTGCCATTAC GCTATGCCAA GAAAACAACA TTCCTGGTAA GGAGAGAGCT
GTCAGTTTCT GAGACTTGAT ACAGTGTTTG ATTTGCATTC TTTTTAATTT GGCCTGTAAT CTTGCAGTTG TCGTGTTTAA
TTTGCAAAAA CCTGGAAATA TTGCGAAAGC TATTGTTGGT GAGAAGGTTG GCACGTTTAT AGGCTGCACA AAAGATCAGG
ACCAGATTGT GGGGAATGCA CTGGATCAAG AAAGAAGATT GGTGAACGAG TTATGATTTC ACTGGAGCTC TCTGTCGCTA
GCTGTGTAGC TGCATTGCCT ATTGCTTGGT AACATGTGGA TCTCTAGAGT TTTTAGGCTA GAATAGCTTA TCCAAATCCT
GGTTCCTTGT ACAACCTTTG AGCAAAAATA AAAAAACCAA TGGTAACAGA GATTTTCCAG CTGATATAGC TGCTATGTTG
TCATACTATG TACAATGGAA TCTAGAGCAA TCTGATAAAT CACATTTATA TCTTAAAATC ATTGCATGTG GCATGTATGA
TGTCTTCACC T

Locus: Os01g0965400

Loading...

Locus: Os01g0965400

Loading...