Os01t0965500-01

Locus

Os01g0965500

Description

Similar to SET domain protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsSET6, SDG720, OsPHD7, PHD7

Oryzabase Gene Name Synonym(s)

SET protein 6, Plant homeo-domain finger protein 7, PHD finger protein 7

Transcript Evidence

AK241918 (DDBJ, Best hit)

Protein Evidence

XP_002318442.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Molecular Function: zinc ion binding (GO:0008270)

Functional domain (InterPro)

SET domain (IPR001214)

Zinc finger, PHD-type (IPR001965)

Zinc finger, FYVE/PHD-type (IPR011011)

Zinc finger, RING/FYVE/PHD-type (IPR013083)

Zinc finger, PHD-finger (IPR019787)

Full-length cDNA

J075073G20 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0965500-01)

Others

Oryzabase (13374)

KEGG (Os01t0965500-01)

Transcript

1384 bp

>Os01t0965500-01 Similar to SET domain protein.
TGCGACGTGTGCGGGTCCGGGGAGCGGGACGAGGAGCTGCTGCTGTGCGACGGCTGCGAC
CGCGGCCGCCACACCTTCTGCCTCCGCCCCATCGCCGCCAGGGTCCCCACCGGCCCCTGG
TTCTGCCCGCCATGCGCCCCGCGCTCCAAGCCCGTCAAAAGGTTCCCGATGACTCAGACG
AAGATCGTTGATTTCTTCCGGATTCAGAAGGGCGCAGAGGATGCCGAGGCGGAGAAATAT
GGGCTTTTTCAAGATGTTAAGAAGCGAAGAAAGCGTTCCCTTGTTATGCACAAGAAGAGG
AGGAGGATACTGCCATATGTCCCAACTGAAGATAAAGTTCAAAGGCTCAAACAAATGGCT
TCTCTAGCCACTGCTATGACATCTTCGAAGATGAAGTTCAGTAATGAGCTGACTTACATG
CCTGGTATGGCTGGGAGATCGTGTAATCAAGCTACACTGGAAGAAGGTGGCATGCAGATT
CTTCCAAAAGAGGATAAGGAAACTATAGAACTTTGCAGAACCATGCAAAAAAGGGGAGAA
TGCCCTCCCCTTCTTGTGGTGTTTGATTCACGCGAAGGGTTCACAGTGCAGGCTGATGCT
GATATTAAAGATATGACCTTCATCGCCGAATATACTGGAGATGTTGATTTTTTGGAAAAC
AGAGCAAATGATGATGGTGACAGTATAATGACTCTTCTTTTGACAGAAGATCCTTCCAAA
AGGCTGGTTATTTGTCCTGATAAGCGTGGAAACATTTCCCGTTTCATTAATGGCATTAAT
AATCACACTCTGGATGGCAAAAAGAAGAAGAATATTAAATGTGTCCGGTATGACATAGAT
GGTGAGAGCCATGTCTTGTTGGTTGCCTGCCGTGATATAGCTTGTGGTGAGAAGCTATAT
TATGATTACAATGGATATGAGCATGAGTACCCAACTCATCATTTTGTCTAACTTAGTCTA
GTTTTGTTACCTGCCCAGCATTAAGGACCCTGGGCAAGTGTAGGGCTTAATGGCAACATT
TTCAGCATTGCCACCAAAATCCAATAATTTATAACATATATCTTTGGTACAAATGAAAAG
TTAAAACCAATTTTCAGAAGCAGCCCTGAATGACAAAAATGTAGGTGCTGGTGATATTAG
GAGTGAGAGCAATCTTCTCAGCTGTTGGGACAAGAGGAATCTTCATTTTTCCTGGTCTCC
AAGATGCAATCTTCTCATTGATATTTTTTATTTATTCTGGAGCTTCCTGCTCAAATTCTC
TTCTTTTTAGGGATTTTCATCCCTTTATGTGGGAGTAAATATGTGTCTTTGTATCTATTT
AAAAGAGTGATGTAATGAGGCAGTAACTGCTCCCTTTTAAATAAAGACACATTTTTCATT
GGAG

CDS

951 bp

>Os01t0965500-01 Similar to SET domain protein.
TGCGACGTGTGCGGGTCCGGGGAGCGGGACGAGGAGCTGCTGCTGTGCGACGGCTGCGAC
CGCGGCCGCCACACCTTCTGCCTCCGCCCCATCGCCGCCAGGGTCCCCACCGGCCCCTGG
TTCTGCCCGCCATGCGCCCCGCGCTCCAAGCCCGTCAAAAGGTTCCCGATGACTCAGACG
AAGATCGTTGATTTCTTCCGGATTCAGAAGGGCGCAGAGGATGCCGAGGCGGAGAAATAT
GGGCTTTTTCAAGATGTTAAGAAGCGAAGAAAGCGTTCCCTTGTTATGCACAAGAAGAGG
AGGAGGATACTGCCATATGTCCCAACTGAAGATAAAGTTCAAAGGCTCAAACAAATGGCT
TCTCTAGCCACTGCTATGACATCTTCGAAGATGAAGTTCAGTAATGAGCTGACTTACATG
CCTGGTATGGCTGGGAGATCGTGTAATCAAGCTACACTGGAAGAAGGTGGCATGCAGATT
CTTCCAAAAGAGGATAAGGAAACTATAGAACTTTGCAGAACCATGCAAAAAAGGGGAGAA
TGCCCTCCCCTTCTTGTGGTGTTTGATTCACGCGAAGGGTTCACAGTGCAGGCTGATGCT
GATATTAAAGATATGACCTTCATCGCCGAATATACTGGAGATGTTGATTTTTTGGAAAAC
AGAGCAAATGATGATGGTGACAGTATAATGACTCTTCTTTTGACAGAAGATCCTTCCAAA
AGGCTGGTTATTTGTCCTGATAAGCGTGGAAACATTTCCCGTTTCATTAATGGCATTAAT
AATCACACTCTGGATGGCAAAAAGAAGAAGAATATTAAATGTGTCCGGTATGACATAGAT
GGTGAGAGCCATGTCTTGTTGGTTGCCTGCCGTGATATAGCTTGTGGTGAGAAGCTATAT
TATGATTACAATGGATATGAGCATGAGTACCCAACTCATCATTTTGTCTAA

Protein

317 aa

>Os01t0965500-01 Similar to SET domain protein.
CDVCGSGERDEELLLCDGCDRGRHTFCLRPIAARVPTGPWFCPPCAPRSKPVKRFPMTQT
KIVDFFRIQKGAEDAEAEKYGLFQDVKKRRKRSLVMHKKRRRILPYVPTEDKVQRLKQMA
SLATAMTSSKMKFSNELTYMPGMAGRSCNQATLEEGGMQILPKEDKETIELCRTMQKRGE
CPPLLVVFDSREGFTVQADADIKDMTFIAEYTGDVDFLENRANDDGDSIMTLLLTEDPSK
RLVICPDKRGNISRFINGINNHTLDGKKKKNIKCVRYDIDGESHVLLVACRDIACGEKLY
YDYNGYEHEYPTHHFV*

CDS

chr01:42568151..42568310 (+ strand) : 160 bp

chr01:42568460..42568552 (+ strand) : 93 bp

chr01:42571388..42571611 (+ strand) : 224 bp

chr01:42571689..42571789 (+ strand) : 101 bp

chr01:42571871..42572083 (+ strand) : 213 bp

chr01:42572485..42572644 (+ strand) : 160 bp

3'UTR

chr01:42572645..42573077 (+ strand) : 433 bp

FASTA

>Os01t0965500-01 class=Sequence position=chr01:42568151..42573077 (+ strand)
TGCGACGTGT GCGGGTCCGG GGAGCGGGAC GAGGAGCTGC TGCTGTGCGA CGGCTGCGAC CGCGGCCGCC ACACCTTCTG
CCTCCGCCCC ATCGCCGCCA GGGTCCCCAC CGGCCCCTGG TTCTGCCCGC CATGCGCCCC GCGCTCCAAG CCCGTCAAAA
GTGCGTCGCC GTGCGTGCCG CCACGCACGA TCTCGCCCAT TTCCATCCTT TTCTAATTTC TCACCCCCTT TTTCTTTTCT
CTCGTGCTTC GGATTGTTCT TATCTCACTG TTTTTCTCCT TGTGTCTTCG GTGGCGTGGG GGGTGTTAGG GTTCCCGATG
ACTCAGACGA AGATCGTTGA TTTCTTCCGG ATTCAGAAGG GCGCAGAGGA TGCCGAGGCG GAGAAATATG GGCTTTTTCA
AGGTAATTTT GCATTTGGGA AAAGTGCACC ATTGTTCTAT AAGTCTGAAT TGTGATACCA TTTTGATTGC TTGGAGTGCC
TTACTGATGA TACAGTGGTT AGCTTATGGA TAGGATTCCA TCTTATAATT TGTGTGGCTT AAGCTTTTGT AGTAGTGGTG
ACAAATAGCG ACATTCATGC TACTGCTAAT TATCTGATTA TCAGTATGAT CTACCTGGTT AGGACCGTTC AGTAGCAGAG
ATTCTGCTAT TATGCAACCT ATATTTTTAT TATGCGTAAT GTAGGTCAAT TCTAGTGTAG TTTTCCAATT ACGCTTTGTA
GGACTTGTGG TGATGGTGAG AAATAGCCAC ATGATAAGCG TACTGTGCTA CAGCTGAATA TATAAGTGGA TATATCCGGG
CTtgtccaga tttattccta gaagttgatt ctttttggga cggagggtgt atccaATAGG AGCGTTTAGT AGTACAGATT
CTGTTAGTAT GCAATTTATA TTTCTGTGCA CAATGTACGT TAACTCTAGA GTTGTTTTGG CTGCATATCT AGTTAGTAGA
TGCAATAGGT GGGAATAGAC AATACTGTGA CCCTCCAATA TGAAATGCTC ACTTACGTCT CCACTGGAAA TACGCGGGAA
AGCTCTCCCT GCTGTAAATA GGTGGGGAAG TTATATTGAG CAAGCATTTA AGATGTAATA ATGGTGCATG CATTCGTAAT
AGCAACAAGA ATGTGTAATT TTGCAATTGG GAGAGGTCAT GAAAAGTGCA CCATTGTACA AGTCTGAATT GGGAGACCAT
TATGATTGCG TGGGGTACCT TATTGATGAT ACAATGGTGA GGCTTATGGA TTGGATTCTA TCATATATTC GTGTGGCTTA
AGCTTTTGTA GTGGTGGTGA GTAGCCACAT GATAAGCATA CCGTGCTACT GCTAATTATC TGGTTATCAG TATGACATAC
TCCCCCCATC CCAAAACAAA TCAACTTCTA GCTAGGTTAT CAGTATGACA TACTCCCCCC ATCCCAAAAC AAATCAACTT
CTAGCTATGT ATCAGCTAGA AGTTGATTCT TTTTAGGACA GAAGGTGTAC CTGATAGGAG CGATCAGTAG CAGAGATTCT
GTTATTATGC AACCTATATT TTTATGTGTA ATGTAGGTCA ATTCTAGTGT AGTTTTGCCT TAAGCTTTTG TAGACTTGTG
GTGGTGGTGA GAAACATCCA CATGATAAGC ATACCGTGCT AATGCTGAAT ACATAAGTGG TTATCGCTAT GATTtactct
ccgtccaaga aaagatcaac ttttggggat gaatctgggc tagtccagat tcattcctag aaattgattc tttttgggat
ggagggtgta TCCAATAGAA GCGTGCAGTT GTATAGATTC TGTTAGTGTG CAATTTATAT TTCTGTGTGC AATGTATGTT
AACTCTAGAG TTGTTGGGCT GCATAGGCGG GAATAGACAA TGTTGCGACC TTCCAATATG AAATGCTCAC TTATGTTACC
ACTGGAAGTA CGCGGGAAAG CTTTCCTTGT TGTAAATAGG TGGGAAAGTT GTATTGAACA AGCATTTAAT TCATGTAACA
ATGGTGCATG CATTCGTAGT AGCAATAAGA ACATGTAACT TTGCAATTGG GAGAGGTCAT GAAAAGTGTT CCATTGTACA
AGTCTGAATT GTGAGACCAT TTTGATTGTG TGGGGTGCCT TATTGCTGAT ACAGTGGTGA GGCTTATGGA TTGGATTCCA
TCATATATCC GTGTGGCCTA AGCTTTTGTA GTGGTGATGA GAAATAGACA CATGATAAGC ATACCACACT ACTGCTAATT
ATCTTTGGTT ATCAGTATGA CGtactccct ctgtcccaag acaaatcaac ttctggctat gtatcagcta gaagttgatt
cttttcgcga cggagggtgt acctgatagg AGCGATTAGT AGCAGAGATT TTGTTATTAT GCAACCTATA TTTTTATGCG
TAATGTAGGT CAATTCTAGT GTTGTTTTGC CTTACGCTTT CCCCACTGTA ATAGGCGGGA CAATTATATT GCACAAACAT
TTAATTGATG TTATAATGGT GCACACATTC ATAATAGAAA TAGGAATGTG TGATTGCCAC AAAGATCATG TAATTTACTG
CTTTTTTGAT CGGTCAAACT ATATGGATTG ACCAACTTCC ATCAATGCTG CTAGTATTTT TATGATCCGC TCTGCATTCA
GTTAGCCATA AAATAGCTCC CATGTTGCCA TAATGATCCA TACAAGCATC GGTCTTATTA TCACTGCTTT GTGAATATGT
TTGTACAAGC TTTACAAAGC TGTAGCGTTA TTCCAGAGCA GTTCATTAGC TTATGTTAGC TACACTTTTG CTGAATAAAG
AAAATAGCAC ATGTTTGCTA GTTAATATGA TAGACATAAC AACAAAGTAT TCTTGCATAC CAGAAATTAT TTAAACATGC
TTGGTTGTAA TAGAAACATT GTCACTGAGG TATTCGAATG GAAGAGTTTT AAGTATGTTG CACCACTTCT CGAACATGCT
CTTGGTTCAG ATATCAGAAA TTCATAATAT AGATATAAAT ATTTTTCAAG AAACTTGGCA AAAACCATTC TTTGGATGCT
CTTGTTTTCC ATGGTTGAAT ATTCATTGAA ATTAAGTTCT TGTGAAATTT CCGTGCCTAT CATATATTGT ACCAATTAAA
CTCTTGAAGA TTGATCCAAT GTTTGCAAGA TGGCTGACAG TTTGACCGCA AGACTTAGTT GTTCAATTGT GTCAAGCAGT
TGACTTAACA TAGCTAATTT ACTTTATACT TGTGTAGATG TTAAGAAGCG AAGAAAGCGT TCCCTTGTTA TGCACAAGAA
GAGGAGGAGG ATACTGCCAT ATGTCCCAAC TGAAGATAAA GTTCAAAGGC TCAAACAAAT GGCTTCTCTA GCCACTGCTA
TGACATCTTC GAAGATGAAG TTCAGTAATG AGCTGACTTA CATGCCTGGT ATGGCTGGGA GATCGTGTAA TCAAGCTACA
CTGGAAGAAG GTGGCATGCA GGTTAGCAAG TCGTTTAATG CAAACAATTT TATTTTGTTG GCCCTTTGGT AGATAATGAT
ACACTCTTCA ATTTCTAGAT TCTTCCAAAA GAGGATAAGG AAACTATAGA ACTTTGCAGA ACCATGCAAA AAAGGGGAGA
ATGCCCTCCC CTTCTTGTGG TGTTTGATTC ACGCGAAGGG TACTTTCTAA ACTATGATCA GATATATTTA GCTTTGCAGT
ATCAGTATAC ATAATTAGAC TAATCCATGA TAATTTTCAG GTTCACAGTG CAGGCTGATG CTGATATTAA AGATATGACC
TTCATCGCCG AATATACTGG AGATGTTGAT TTTTTGGAAA ACAGAGCAAA TGATGATGGT GACAGTATAA TGACTCTTCT
TTTGACAGAA GATCCTTCCA AAAGGCTGGT TATTTGTCCT GATAAGCGTG GAAACATTTC CCGTTTCATT AATGGCATTA
ATAATCACAC TCTGTAAGTA TAATCTTCGT TCTTTTTTAC CTTATGTTTT TTACATTTTG TGGCCTTCAA GATGCAACTT
TTACCATCAC TGTTTATTGC ATTAACTTGA GATATGATAA TAAAACTATA ATATTCTGAA AACATTTTTC ATAATAAATC
ATAGTTTTAA GCCTACTAAT GGACAAACTT TAGAAATGTT GACGCCACAT ATTCTAAGGC ATCAAGTAGT TGCATTTAAA
TTCTTATAAT TGCATAAGTA CATAATTAGG CGTCTGTCTG ACATGTCAAA CCATCTTTAT TTCTGCATTC CTTCAATAAA
ATACTCTGTT CTCAAATATA GGAAGACTGA CTCTATGCTT GATGTTGGAA AGACTGCTAT CGTTCCTAAA TTTGAAAATG
TTAAATCTTT GCAGGGATGG CAAAAAGAAG AAGAATATTA AATGTGTCCG GTATGACATA GATGGTGAGA GCCATGTCTT
GTTGGTTGCC TGCCGTGATA TAGCTTGTGG TGAGAAGCTA TATTATGATT ACAATGGATA TGAGCATGAG TACCCAACTC
ATCATTTTGT CTAACTTAGT CTAGTTTTGT TACCTGCCCA GCATTAAGGA CCCTGGGCAA GTGTAGGGCT TAATGGCAAC
ATTTTCAGCA TTGCCACCAA AATCCAATAA TTTATAACAT ATATCTTTGG TACAAATGAA AAGTTAAAAC CAATTTTCAG
AAGCAGCCCT GAATGACAAA AATGTAGGTG CTGGTGATAT TAGGAGTGAG AGCAATCTTC TCAGCTGTTG GGACAAGAGG
AATCTTCATT TTTCCTGGTC TCCAAGATGC AATCTTCTCA TTGATATTTT TTATTTATTC TGGAGCTTCC TGCTCAAATT
CTCTTCTTTT TAGGGATTTT CATCCCTTTA TGTGGGAGTA AATATGTGTC TTTGTATCTA TTTAAAAGAG TGATGTAATG
AGGCAGTAAC TGCTCCCTTT TAAATAAAGA CACATTTTTC ATTGGAG

Locus: Os01g0965500

Loading...

Locus: Os01g0965500

Loading...