Os01t0970600-01

Locus

Os01g0970600

Description

DEAD-box RNA helicase (EC:3.6.4.13), Salt or drought stress tolerance, RNA chaperon activity

RAP-DB Gene Symbol Synonym(s)

OsRH58

RAP-DB Gene Name Synonym(s)

RNA helicase 58

CGSNL Gene Symbol

RH58

CGSNL Gene Name

RNA HELICASE 58

Oryzabase Gene Symbol Synonym(s)

OsRH58

Oryzabase Gene Name Synonym(s)

RNA helicase 58

Transcript Evidence

AK288993

Protein Evidence

Q0JFN7

Literature

PMID: 30626336

Note

Manual Curation

January 16, 2019

Gene Ontology (GO)

Molecular Function: nucleic acid binding (GO:0003676)

Molecular Function: ATP binding (GO:0005524)

Functional domain (InterPro)

P-loop containing nucleoside triphosphate hydrolase (IPR027417)

RNA helicase, DEAD-box type, Q motif (IPR014014)

Helicase superfamily 1/2, ATP-binding domain (IPR014001)

DEAD/DEAH box helicase domain (IPR011545)

Helicase, C-terminal (IPR001650)

Experimentally confirmed subcellular location

chloroplast (GO:0009507)

Full-length cDNA

J090087O04 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0970600-01)

Others

Oryzabase (19163)

Transcript

1705 bp

>Os01t0970600-01 DEAD-box RNA helicase (EC:3.6.4.13), Salt or drought stress tolerance, RNA chaperon activity
ggcggcacgagatagtcgaggcggaggcgcatccacccggcgtaggaggctgtcgacggc
gaggagcgacgccacctcctcaaggtgccacccctggaggtaggcggcgacctcgacgCC
TCGCCTGCGGCCGCCTCCGCCTTGCCCGCGGCCGCCGCCGCCGCCTCCGCCTCCGCCTCC
GCGCGCGCCAGCGGCCGCCGCCGCCTCCTCCATGGCCGCGTTCTCCGGCTGCGCTTCGCC
ACTCTCCACCACCCTACGCTCTGGCCTCGCCCCGTTCACGCTGCGCCACCGCCTCCGCCT
CCGTCGACTCCGCGCCTCCGCCGCCACCCTCCGCGAGGTCTGCGCCGGCCGCGTCCCGGA
GCACGTCCTCCAGAGGGCTGAGGAGGTTGGCTATGTCGTCCCTACCGAGGTGCAGGAGCA
ATCCTTGCCTGTCCTCTTGTCTGGCCAAGACTGCATCCTCCACGCACAGACGGGTTCTGG
AAAGACACTTGCCTATCTATTGTCGGTGTTCTCGGCCATAGATTTTGGGAGATCCTCGGT
GCAAGCGCTGGTTGTGGTCCCAACCAGGGAGCTCGGCATGCAGGTTACCAAAGTTGCTCG
AATACTTGCAGCAAAGGCCTGCACCGTTATGGCTTTGCTTGATGGTGGAATGCTAAGGAG
GCAAAAGAGTTGGGTAAAGGCAGAGCCCCCGGCTATAATTGTTGCTACTGTTGCAAGCTT
GTGCCAAATGATTGAGAAGCGTGCTTTCAGTCTTCAGTCTATGAGAGTATTAGTTATTGA
TGAGGTTGATTTTATTTTTGGGTCGTCAAAGCAAGTAAGCTCTCTTCGCAAAATATTAAC
ATCTTATTCAGCAGCTTCCAGTCGTCAGACCATATTTGCTAGCGCATCGATTCCTCAGCA
CAATCGCTTTGTGCATGACTGTGTGCAACATAAGTGGACTAAGACTGATGTGGTTCATGT
TCATGTCAACCCTGTACAACCCATGCCCTCTCACCTCCAGCACAAATATGCGATCTGCAG
TAAGAAGGAAAGGTTGCATGTTTTACTATCCTTGCTTGAGAAGGATGCACCAAAGTCAGG
GATTATATTTGTTGCTGAACAGTCTGAGAAATCAAAGAAGGCTGGACACCCTCCTTCAAC
TACTGTTGTTGTTGAATTCCTGAGAACTACGTACATGGGAAGCCTAGAGGTCCTTCTACT
GGAAGAAGATATGAATTTCAATGCCCGTGCTACATCATTCACCGAGGTCAAGGGAAAAGG
CTTTCTTCTAGTTTCCACTGACATAGCAAGCAGAGGGTTTGACCTCCCACAAACCAGCCA
CATATACAACTTTGACCTTCCCAAGACGGCTATTGACTATCTGCATCGTGCTGGAAGAAC
TGGGAGAGAACCATTCTCCAAGTTAGCTTGCAGCGTGACAACCCTCATAACAGAGGATGA
GCACTTTGTATTACAGAGATTTCAGAATGAACTCAAGTTCCATTGTGAAGAGCTACCTGT
AGAATCCATGTTCGCATTTAACTTGTGACGTCCCTCACTGGATGTAAATAGCCATTTCTC
TTGATTTCATCCCCCGGTTGGAGGTTTTTCTTTTTTCTGTTTAATCTAGATGAAGAGGTT
TGAACAAGTGTCCTGGTTATTTTCCCTCTGGAGAGTGGAGAAAGATGTTGAACGTATTTA
TATTAAAGCATAAAGTTGTTATGTA

CDS

1317 bp

>Os01t0970600-01 DEAD-box RNA helicase (EC:3.6.4.13), Salt or drought stress tolerance, RNA chaperon activity
ATGGCCGCGTTCTCCGGCTGCGCTTCGCCACTCTCCACCACCCTACGCTCTGGCCTCGCC
CCGTTCACGCTGCGCCACCGCCTCCGCCTCCGTCGACTCCGCGCCTCCGCCGCCACCCTC
CGCGAGGTCTGCGCCGGCCGCGTCCCGGAGCACGTCCTCCAGAGGGCTGAGGAGGTTGGC
TATGTCGTCCCTACCGAGGTGCAGGAGCAATCCTTGCCTGTCCTCTTGTCTGGCCAAGAC
TGCATCCTCCACGCACAGACGGGTTCTGGAAAGACACTTGCCTATCTATTGTCGGTGTTC
TCGGCCATAGATTTTGGGAGATCCTCGGTGCAAGCGCTGGTTGTGGTCCCAACCAGGGAG
CTCGGCATGCAGGTTACCAAAGTTGCTCGAATACTTGCAGCAAAGGCCTGCACCGTTATG
GCTTTGCTTGATGGTGGAATGCTAAGGAGGCAAAAGAGTTGGGTAAAGGCAGAGCCCCCG
GCTATAATTGTTGCTACTGTTGCAAGCTTGTGCCAAATGATTGAGAAGCGTGCTTTCAGT
CTTCAGTCTATGAGAGTATTAGTTATTGATGAGGTTGATTTTATTTTTGGGTCGTCAAAG
CAAGTAAGCTCTCTTCGCAAAATATTAACATCTTATTCAGCAGCTTCCAGTCGTCAGACC
ATATTTGCTAGCGCATCGATTCCTCAGCACAATCGCTTTGTGCATGACTGTGTGCAACAT
AAGTGGACTAAGACTGATGTGGTTCATGTTCATGTCAACCCTGTACAACCCATGCCCTCT
CACCTCCAGCACAAATATGCGATCTGCAGTAAGAAGGAAAGGTTGCATGTTTTACTATCC
TTGCTTGAGAAGGATGCACCAAAGTCAGGGATTATATTTGTTGCTGAACAGTCTGAGAAA
TCAAAGAAGGCTGGACACCCTCCTTCAACTACTGTTGTTGTTGAATTCCTGAGAACTACG
TACATGGGAAGCCTAGAGGTCCTTCTACTGGAAGAAGATATGAATTTCAATGCCCGTGCT
ACATCATTCACCGAGGTCAAGGGAAAAGGCTTTCTTCTAGTTTCCACTGACATAGCAAGC
AGAGGGTTTGACCTCCCACAAACCAGCCACATATACAACTTTGACCTTCCCAAGACGGCT
ATTGACTATCTGCATCGTGCTGGAAGAACTGGGAGAGAACCATTCTCCAAGTTAGCTTGC
AGCGTGACAACCCTCATAACAGAGGATGAGCACTTTGTATTACAGAGATTTCAGAATGAA
CTCAAGTTCCATTGTGAAGAGCTACCTGTAGAATCCATGTTCGCATTTAACTTGTGA

Protein

439 aa

>Os01t0970600-01 DEAD-box RNA helicase (EC:3.6.4.13), Salt or drought stress tolerance, RNA chaperon activity
MAAFSGCASPLSTTLRSGLAPFTLRHRLRLRRLRASAATLREVCAGRVPEHVLQRAEEVG
YVVPTEVQEQSLPVLLSGQDCILHAQTGSGKTLAYLLSVFSAIDFGRSSVQALVVVPTRE
LGMQVTKVARILAAKACTVMALLDGGMLRRQKSWVKAEPPAIIVATVASLCQMIEKRAFS
LQSMRVLVIDEVDFIFGSSKQVSSLRKILTSYSAASSRQTIFASASIPQHNRFVHDCVQH
KWTKTDVVHVHVNPVQPMPSHLQHKYAICSKKERLHVLLSLLEKDAPKSGIIFVAEQSEK
SKKAGHPPSTTVVVEFLRTTYMGSLEVLLLEEDMNFNARATSFTEVKGKGFLLVSTDIAS
RGFDLPQTSHIYNFDLPKTAIDYLHRAGRTGREPFSKLACSVTTLITEDEHFVLQRFQNE
LKFHCEELPVESMFAFNL*

5'UTR

chr01:42824833..42825043 (- strand) : 211 bp

CDS

chr01:42824669..42824832 (- strand) : 164 bp

chr01:42824504..42824597 (- strand) : 94 bp

chr01:42824289..42824402 (- strand) : 114 bp

chr01:42824096..42824191 (- strand) : 96 bp

chr01:42823702..42823806 (- strand) : 105 bp

chr01:42823372..42823530 (- strand) : 159 bp

chr01:42823197..42823265 (- strand) : 69 bp

chr01:42822725..42822814 (- strand) : 90 bp

chr01:42821817..42821957 (- strand) : 141 bp

chr01:42821431..42821715 (- strand) : 285 bp

3'UTR

chr01:42821254..42821430 (- strand) : 177 bp

FASTA

>Os01t0970600-01 class=Sequence position=chr01:42821254..42825043 (- strand)
ggcggcacga gatagtcgag gcggaggcgc atccacccgg cgtaggaggc tgtcgacggc gaggagcgac gccacctcct
caaggtgcca cccctggagg taggcggcga cctcgacgCC TCGCCTGCGG CCGCCTCCGC CTTGCCCGCG GCCGCCGCCG
CCGCCTCCGC CTCCGCCTCC GCGCGCGCCA GCGGCCGCCG CCGCCTCCTC CATGGCCGCG TTCTCCGGCT GCGCTTCGCC
ACTCTCCACC ACCCTACGCT CTGGCCTCGC CCCGTTCACG CTGCGCCACC GCCTCCGCCT CCGTCGACTC CGCGCCTCCG
CCGCCACCCT CCGCGAGGTC TGCGCCGGCC GCGTCCCGGA GCACGTCCTC CAGAGGTGCT TCCCTCTCTT CCTCGTTCGA
GATTTTTTTT TAATTATTTA TGCTCATGGG TTTAATTTTC TTCCAGGGCT GAGGAGGTTG GCTATGTCGT CCCTACCGAG
GTGCAGGAGC AATCCTTGCC TGTCCTCTTG TCTGGCCAAG ACTGCATCCT CCACGCACAG GTGCTGTTCC TCCTCCTCCT
CAAGCTTTGC TTACTCTCCT TAGATTGTTT CATGCTGTAC AGTGATAGCA ATCTGATCTT ACTATTGCTG GTTGAATGTA
GACGGGTTCT GGAAAGACAC TTGCCTATCT ATTGTCGGTG TTCTCGGCCA TAGATTTTGG GAGATCCTCG GTGCAAGCGC
TGGTTGTGGT CCCAACCAGG GAGCTCGGCA TGCAGGTGAT AAGCTGCTTG GCTGCTTGCT ATGCAATTAT CTTCCACCTG
CCTTGTGCGT CCCTTCTAAC TCACCTTGTT GCTGTTATTG TGCCAATGTA AGGTTACCAA AGTTGCTCGA ATACTTGCAG
CAAAGGCCTG CACCGTTATG GCTTTGCTTG ATGGTGGAAT GCTAAGGAGG CAAAAGAGTT GGGTAAAGGT ATTTTCAGTC
TATGCTCAAT AGCTAATTCT TCAGTTCCTA GCCCAAAAAG AAAACTGTGA TAGTGCTTCA GTTTAATACA GGAGCATTTT
AGCCATGCCG TGGTTATGTC CATATCTCCC TTTGATATTA GTTTTCAGGC CTCTTGGTGT AAATGTTGCC AAATTGGTTA
TACTGATGTA CGCACTTCAC TTTCTTTTTG TTTCTACTTG ACGCATAAAG AGCAGGCTAT TTAAATTTCT CTTACCTGTT
GTTTGCTTCC CCGCTGACTA TATTGATCTA TTTCCAGGCA GAGCCCCCGG CTATAATTGT TGCTACTGTT GCAAGCTTGT
GCCAAATGAT TGAGAAGCGT GCTTTCAGTC TTCAGTCTAT GAGAGTATTA GTTATTGATG AGGTGATTCT TGAGTCCTAA
ATCAAACTTT TTTGCAGTAT AAGCTCAGTC TGCTAATGCA ATATCTGACT CTGTATATTT GCAAAGAGCC CAAGAGGCTA
TTTGAAGTTT GGAACTCATT TAGTTGATTT TTTTCAAGAC AGAATACCTA ATGTACTCAT TGCTGTTTGA TAGGTTGATT
TTATTTTTGG GTCGTCAAAG CAAGTAAGCT CTCTTCGCAA AATATTAACA TCTTATTCAG CAGCTTCCAG TCGTCAGACC
ATATTTGCTA GCGCATCGAT TCCTCAGCAC AATCGCTTTG TGCATGACTG TGTGCAACAT AAGTGGACTA AGGTTGCACT
TCTTTATCTA TATGGCTTGA ACGTACACTA TTATTATTGA ATGAAAAGAT GGACCTTTTT GACCTCATGT TTGCATATTC
TGTCTTATCT GTGTGCAGAC TGATGTGGTT CATGTTCATG TCAACCCTGT ACAACCCATG CCCTCTCACC TCCAGCACAA
ATATGCGGTG GGCATATAAA TTTCTTTTTA TGATAATCTT ACATTCTAAA TGCCTTCAAT CATTTCCTAC AACTGTGGAA
CTTAATACCT GTCTTGAACA TAGTAAATAG GCGTGTTTCA GTTGGGGCCT AAAACCTAAA CCCACAGGCA CGGGCATTCC
TTGCATAAGC TCATTAAACA GCATGCATGT GATTATGGCA AAAGTTTAGT CCTTTTACAA AGCATTGCAC ATCTTCTTTT
AGTTTTCAGT GATCTCATGA GTCTCTTTTA CTTTTCTGTT CCTGAAAAAT CTTGCGAGTA TGGGTGACTA ACCCCCTTGC
TCCTGAAAAA TATCTTTTGA CCTGATTTTT GTTCTTGCTG ATTATGGTAA TTTTTTAATT AATGTACAGA TCTGCAGTAA
GAAGGAAAGG TTGCATGTTT TACTATCCTT GCTTGAGAAG GATGCACCAA AGTCAGGGAT TATATTTGTT GCTGAACAGG
TATTGCTACT TGTGGATTCC ATTTACTCCA TGGCATGTTG ATTATAGTGT TGCTCCAGGG TGATGGGATG TGCCAATTTA
GGGGTTAGAA ATTATTCTAG AGGGACCAAC CGGCCAAGGG ACCTCATGAT GGACCATTTA TGCTATCCTA TATGCAAATA
CAAAATGTTA CTTATCATAG ATAGTCTTTA TCTGCTGGTA TGGAATAATT TTCATTTTTG GTACGATTGA AGATTTAATA
TCTGATTCTG TTTCAATGGG AATCACCAGC TAGTCCATTA GCTGATATTC TTTATTTTTA TCGTTCCTAT GACTAGCAAC
AAAACATTTA ACAAGACTTT AAAAAAAAAT CAAAATGTCC TTTATCATTG TATACCGAAA ATGCCGGGGC GATGGAACCT
ATTAGCATTG TTTGTGTAGG GGTACCGTAC ACTCCAGCAT ATAAGGGTAT TCTGTACTAG CTTGGTGCTA ATGTGCTATG
ATTAATTACC AGCTCCAGAC CATAATATAT ATACATTAAT ATTTCTTGAA AACAGTTCTA TATTTCATTT ACATTACTTC
CAATTTTTAA AACCGTATAT TCAGCATTCA CAGACATTTG TAAGTACTAG CAATTTGGTT TGTTTACTAA CTGGGCAGTA
TCATATGTTT TTCACCAAGG TCTGAGCAAT TCTTTTAGAA CGAATGAATA TTTACTTAAC CAGAATAGTA GTGTGGCAAC
CTCACGTTTG CAGTTTGTTT GTTAACTGTT CAACCTGTTC TGTTAGTCTG AGAAATCAAA GAAGGCTGGA CACCCTCCTT
CAACTACTGT TGTTGTTGAA TTCCTGAGAA CTACGTACAT GGGAAGCCTA GAGGTCCTTC TACTGGAAGA AGATATGAAT
TTCAATGCCC GTGCTACATC ATTCACCGTT CGTGTTCTCT TTCTATTCTT TCTGACGTTC CCACTATAAA GACATGTTTG
ATTTTGAAAA ATCCATATCT TCACACAAGT ATCGATGTTC CTCTGCAGGA GGTCAAGGGA AAAGGCTTTC TTCTAGTTTC
CACTGACATA GCAAGCAGAG GGTTTGACCT CCCACAAACC AGCCACATAT ACAACTTTGA CCTTCCCAAG ACGGCTATTG
ACTATCTGCA TCGTGCTGGA AGAACTGGGA GAGAACCATT CTCCAAGTTA GCTTGCAGCG TGACAACCCT CATAACAGAG
GATGAGCACT TTGTATTACA GAGATTTCAG AATGAACTCA AGTTCCATTG TGAAGAGCTA CCTGTAGAAT CCATGTTCGC
ATTTAACTTG TGACGTCCCT CACTGGATGT AAATAGCCAT TTCTCTTGAT TTCATCCCCC GGTTGGAGGT TTTTCTTTTT
TCTGTTTAAT CTAGATGAAG AGGTTTGAAC AAGTGTCCTG GTTATTTTCC CTCTGGAGAG TGGAGAAAGA TGTTGAACGT
ATTTATATTA AAGCATAAAG TTGTTATGTA 

Locus: Os01g0970600

Loading...

Locus: Os01g0970600

Loading...