Os01t0971100-01

Locus

Os01g0971100

Description

Drought-induced protein family 19-5, Negative regulation of salt stress tolerance

RAP-DB Gene Symbol Synonym(s)

OsDi19-5

RAP-DB Gene Name Synonym(s)

drought-induced protein 19-5

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsDi19-5

Oryzabase Gene Name Synonym(s)

drought-induced 19-5

Transcript Evidence

AK069516

Protein Evidence

Q5JME8

Literature

PMID: 33179343

Note

Manual Curation

November 13, 2020

Functional domain (InterPro)

Drought induced 19 protein type, zinc-binding domain (IPR008598)

Protein dehydration-induced 19, C-terminal (IPR027935)

Experimentally confirmed subcellular location

nucleus (GO:0005634)

cytoplasm (GO:0005737)

Full-length cDNA

J023022E04 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0971100-01)

RiceXPro (AK069516)

Others

Oryzabase (18580)

KEGG (Os01t0971100-01)

Transcript

895 bp

>Os01t0971100-01 Drought-induced protein family 19-5, Negative regulation of salt stress tolerance
AACTCCACTCACTCTGTGTTTCACTTGCTGCCTTTCAGTTGCAAAGCATAGCTGTTCTCA
CACCTGCCTTGTAGCTAGAGTGGTTAGCAGAGAAGGGAAGCAGTGGAGTTCAGGTTCAGC
CATGGAGGTTGAGGCTTCCTACAGCTATGGCTTCCTTCCTTCAGGCAGGCACCAGCCTTA
TGCACCACCTCCTCCCCACCCTGCAGAGGAAGGCGAATTGTGGGAGTACTTTCCATGCCC
TTTCTGTTACATCGAGGTTGAGGTGCCCTTCATCTGCAACCATCTTCAGGAAGAGCATTG
CTTTGACACCAGAAATGCTGTGTGCCCGTTGTGCGCCGACAATATAGGGAGAGACATGGG
TGCCCATTTCAGAGTTCAACACTCACATCTTCTCAAGAGAAGGAAACCTTCTAGGCCCAG
CAGCTCATGGCCTACACCCTCCAACAATTCAGACCCCTACTTTGAGGGGCCTCCACAGTA
TATGATGAACAACAGGACATACCAAGATCCTGCACCTGATCCACTGCTCTCCCAATTTAT
CTGCAGCATGGCTCAAACTGACACTAACTCGGATAACACAAACACTGAAATTGCAGTTTC
AGCAGTCTCACATGATCAGAGGTTGAGTCAGCGTGTGACTCTGACTGATGATGCATCCAA
GCTGGAACTCAAGGAAAGGTTGCAAAGAATCGAGTTTGTCAAGGAGATAATCATGTCGAC
AATTCTTTAATTTGTTGTCTAGTGTTACTTAGCAAGTTTTATTTATGTTTTGTGTTTTGT
GAGCGCAGATGTATCAGTCATGTATGCGCAACATCCCCTGGCTCACAGATATATAATCTA
TACCATGTAATATTCTAGTAGATGAATGCTTGCATACTTTGGCTCCAAGTTTGTC

CDS

609 bp

>Os01t0971100-01 Drought-induced protein family 19-5, Negative regulation of salt stress tolerance
ATGGAGGTTGAGGCTTCCTACAGCTATGGCTTCCTTCCTTCAGGCAGGCACCAGCCTTAT
GCACCACCTCCTCCCCACCCTGCAGAGGAAGGCGAATTGTGGGAGTACTTTCCATGCCCT
TTCTGTTACATCGAGGTTGAGGTGCCCTTCATCTGCAACCATCTTCAGGAAGAGCATTGC
TTTGACACCAGAAATGCTGTGTGCCCGTTGTGCGCCGACAATATAGGGAGAGACATGGGT
GCCCATTTCAGAGTTCAACACTCACATCTTCTCAAGAGAAGGAAACCTTCTAGGCCCAGC
AGCTCATGGCCTACACCCTCCAACAATTCAGACCCCTACTTTGAGGGGCCTCCACAGTAT
ATGATGAACAACAGGACATACCAAGATCCTGCACCTGATCCACTGCTCTCCCAATTTATC
TGCAGCATGGCTCAAACTGACACTAACTCGGATAACACAAACACTGAAATTGCAGTTTCA
GCAGTCTCACATGATCAGAGGTTGAGTCAGCGTGTGACTCTGACTGATGATGCATCCAAG
CTGGAACTCAAGGAAAGGTTGCAAAGAATCGAGTTTGTCAAGGAGATAATCATGTCGACA
ATTCTTTAA

Protein

203 aa

>Os01t0971100-01 Drought-induced protein family 19-5, Negative regulation of salt stress tolerance
MEVEASYSYGFLPSGRHQPYAPPPPHPAEEGELWEYFPCPFCYIEVEVPFICNHLQEEHC
FDTRNAVCPLCADNIGRDMGAHFRVQHSHLLKRRKPSRPSSSWPTPSNNSDPYFEGPPQY
MMNNRTYQDPAPDPLLSQFICSMAQTDTNSDNTNTEIAVSAVSHDQRLSQRVTLTDDASK
LELKERLQRIEFVKEIIMSTIL*

5'UTR

chr01:42845781..42845901 (+ strand) : 121 bp

CDS

chr01:42845902..42845986 (+ strand) : 85 bp

chr01:42846614..42846726 (+ strand) : 113 bp

chr01:42847294..42847371 (+ strand) : 78 bp

chr01:42847473..42847696 (+ strand) : 224 bp

chr01:42847798..42847906 (+ strand) : 109 bp

3'UTR

chr01:42847907..42848071 (+ strand) : 165 bp

FASTA

>Os01t0971100-01 class=Sequence position=chr01:42845781..42848071 (+ strand)
AACTCCACTC ACTCTGTGTT TCACTTGCTG CCTTTCAGTT GCAAAGCATA GCTGTTCTCA CACCTGCCTT GTAGCTAGAG
TGGTTAGCAG AGAAGGGAAG CAGTGGAGTT CAGGTTCAGC CATGGAGGTT GAGGCTTCCT ACAGCTATGG CTTCCTTCCT
TCAGGCAGGC ACCAGCCTTA TGCACCACCT CCTCCCCACC CTGCAGGTAT GCTTGCTTGA TCCATGGATG CAAACCATGC
GTTCTTGTGG CACTTCTACT TCTTGTTCCT ACAGTTCTTG GATGAATAGT TTCTGCTTAT TGCTTCCTCT CTTCAGCTAA
ATTTGCTATC AGATTGTTCT CTGCATCTGT ATTGTGCTGT AACAGATTCA TGTCTTCTTG TGGCACTTTT ACTTCTTGTT
CCTTCAGTCC TTGAATGAAT AGTTTCTGCT TATTGCTTCA TCTCTTCAGT CAAATTTGCT ATCAGACAGT TCTTTGCATC
TATATCGTGC TGTAACAGCT TCATGTATTT TCCTGGCCTT TCTTGAAGAG TATAGCTATG TTTGTCAATG AATTTCTATG
CACCTTTTTC CTTGAGTTTT CTGTCACTAT TTTGTGGTTG TTTGCAAGCA TTTAGAAGCA TTGGCTTGGT CTTCAGATAC
AACCAAAAAA AATGCGCTTC TTTCTTGCCT TCTCGTTTAC CTTGACTTAT GGGAATCATT GCAAGATTGA GAAGAAAGCT
GAACACCTGG CCTTTTTCTT CAATTCAAGG ACTAGCATAA AAGAAAAAAT AAGTTTGATT AATGATGACT TGACTTACAA
CATTTTTAAC TGGTTTCTTC TTATTTGATT CAGAGGAAGG CGAATTGTGG GAGTACTTTC CATGCCCTTT CTGTTACATC
GAGGTTGAGG TGCCCTTCAT CTGCAACCAT CTTCAGGAAG AGCATTGCTT TGACACCAGA AATGCTGTAA GAGAGCCTAC
CTCTCAACTT GTTCTATTTC TCTCTGTAGG TTGTTTTTTG GATGGACTAA TATGCAAAAA CCAGCTTTCA TTAATCAAAG
CCTAGTCTTA ATCTAACCAG TTGCTCATGA TGTATATGCA TCTTCAATTA TGAGATAGTA CCTGTATATG CAAGGGAACA
ATAATAGCTT TCTTGGACCA CTTAGCAAAT CTGGAGTTAT AGGGCCCGTG AGTAAGCAAT CTTCTAGAGA CTCCCAAGTC
CTAACATGAT GCTGTATTTA TATTAACACA TTTCAAGGAA CTGACCCTAA TTTCCTCTCA TAGAAAAGGA CTTTTGTGAA
GTAATCTCTG GATGAAATTA TTGTTGCTTA ACAAGAACTT GTGTTAACAA TTTCAAGAAA CTTAGCATAA GTTACTGACA
TATGAGACAA TTACTCGTTC ATACTACAAA TGTGGAATAT ACACAAATTA GATAAAGTTC CATGCTAAAC TTGTTCCTAA
ACAAATGGTA AACAAGTCAA TTTTATGAAC TTGCTGTCCA TTCTGAAGCT GAGTCGATGT TCATGGAATT CAGGTGTGCC
CGTTGTGCGC CGACAATATA GGGAGAGACA TGGGTGCCCA TTTCAGAGTT CAACACTCAC ATCTTCTCAA GGTACCACTA
ATCCTACTAC TTGAGAACCA ATGCCAGTAT ATTATAAGCA CAATGAATCA TTCACTTCAT CATCTGATCA AACATAAATC
TGAACATGGC AGAGAAGGAA ACCTTCTAGG CCCAGCAGCT CATGGCCTAC ACCCTCCAAC AATTCAGACC CCTACTTTGA
GGGGCCTCCA CAGTATATGA TGAACAACAG GACATACCAA GATCCTGCAC CTGATCCACT GCTCTCCCAA TTTATCTGCA
GCATGGCTCA AACTGACACT AACTCGGATA ACACAAACAC TGAAATTGCA GTTTCAGCAG TCTCACATGA TCAGAGGTAA
ATAAAGATTT CTGTTCATCG TTCAGTAGTT TAGAACTTGG TGTTACTGGA ATACTGGTTA TGAATGCCAA GTAACTGATG
ATGCATTCTT GTTGCAGGTT GAGTCAGCGT GTGACTCTGA CTGATGATGC ATCCAAGCTG GAACTCAAGG AAAGGTTGCA
AAGAATCGAG TTTGTCAAGG AGATAATCAT GTCGACAATT CTTTAATTTG TTGTCTAGTG TTACTTAGCA AGTTTTATTT
ATGTTTTGTG TTTTGTGAGC GCAGATGTAT CAGTCATGTA TGCGCAACAT CCCCTGGCTC ACAGATATAT AATCTATACC
ATGTAATATT CTAGTAGATG AATGCTTGCA TACTTTGGCT CCAAGTTTGT C

Locus: Os01g0971100

Loading...

Locus: Os01g0971100

Loading...