Os01t0972900-01

Locus

Os01g0972900

Description

Similar to Clone ZZD405 mRNA sequence. (Fragment).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsWD40-33, OsCCS52B

Oryzabase Gene Name Synonym(s)

cell cycle switch 52 B, cell cycle switch 52B, B-type cell cycle switch 52

Transcript Evidence

AK109536 (DDBJ, Best hit)

Protein Evidence

B6T9C7 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

WD40 repeat (IPR001680)

WD40 repeat-like-containing domain (IPR011046)

WD40/YVTN repeat-like-containing domain (IPR015943)

WD40-repeat-containing domain (IPR017986)

WD40 repeat, conserved site (IPR019775)

WD40 repeat, subgroup (IPR019781)

WD40 repeat 2 (IPR019782)

Full-length cDNA

002-119-D01 (Online Clone Ordering)

Expression Databases

TENOR (Os01t0972900-01)

RiceXPro (AK109536)

Others

Oryzabase (10714)

KEGG (Os01t0972900-01)

Transcript

1893 bp

>Os01t0972900-01 Similar to Clone ZZD405 mRNA sequence. (Fragment).
TGACCGTTGCAACCTCATCTCCGCTCCTCTTCCTcctcctcgtcgtcgttgtcgtcgtcg
gcggcgcatccagcctcgacgtgccggcgGCGGTGGGTGGCGGGGCAGCAGACGAGCAAG
AAAGAGATCCCTAGTCTCTCTCGATGGCGACGGACGCGTCCCCCAAGCCGGCGCCGCCGC
GCCTCAACGTGCCGCCGGCGATGGCGGGGGGGCTCCGCCTCGATCCCGCCGTCGCCTCCC
CGGCCCGCCTCCTCCTCGACGTCCCCAAGACGCCATCCCCTTCCAAGACCACGTACAGCG
ACCGCttcatcccctgccgctcctcctcccgcctccacaacttcgccctcctcgaccgcg
accgcgcctccccctcctccaccaccgacgacgccccctactcccgcctcctccgcgccg
agatcttcggcccggactccccctccccggctccctcctcccccaacaccaacctcttcc
gcttcaagaccgaccacccctcgcccaaatcgcccttcgccgcctccgccgccgccACCG
CCGGCCACTACGACTGCACCGCCGGCTCCGCTGAATCCTCCACGCCGCGCAAGCCGCCCA
GGAAGGTCCCCAAGACCCCGCACAAGGTCCTGGACGCGCCGTCGCTGCAGGACGACTTCT
ACCTCAATCTTGTCGACTGGTCGTCGCAGAACACGCTCGCCGTCGGCCTCGGGAATTGCG
TCTACCTCTGGTCGGCTTCCAATTGCAAGGTCACCAAGCTCTGCGATTTGGGGCCCAGGG
ACAGCGTCTGCGCTGTGCACTGGACCCGAGAAGGCTCCTATCTTGCCATCGGCACCAGCC
TTGGCGATGTCCAGATTTGGGATAGCTCTCGCTGTAAACGGATTAGGAACATGGGAGGAC
ACCAAACACGGACTGGTGTATTAGCATGGAGCTCCCGAATCTTGTCCTCCGGTAGCAGGG
ACAAGAACATATTGCAGCATGACATCCGTGTCCCAAGTGACTATATCAGCAAGTTCTCAG
GGCACAGATCAGAGGTCTGTGGACTGAAATGGTCGCACGACGACCGTGAGCTTGCATCCG
GTGGAAATGATAATCAGCTGCTAGTATGGAACCAACGTTCGCAGCAGCCGATATTGAGGC
TGACAGAACACACAGCTGCAGTTAAAGCAATAGCATGGTCACCACATCAGCAAGGCCTCC
TGGCATCAGGTGGTGGAACCGCTGATAGGTGTATCAGGTTCTGGAACACGGTTAATGGAA
ACATGCTGAATTCAGTGGACACAGGCAGCCAGGTTTGTAATCTTGCCTGGTGTAAAAATG
TAAATGAGCTTGTGAGCACTCATGGGTATTCCCAAAACCAAATCATGGTGTGGAAGTACC
CATCTATGTCAAAGGTTGCTACTCTAACTGGACACACGCTGCGAGTGCTTTACCTTGCAA
TGTCACCTGATGGACAGACAATAGTAACAGGAGCCGGGGATGAAACCCTCAGATTTTGGA
ATATTTTTCCTTCAATGAAGACACAGGCTCCTGTTCGTGATATTGGGCTCTGGTCATTCT
CGAGAAGCCACATACGGTGACCATAATAGGAGGCAAAGAAAATGCATATGTTTGTATGAA
ACATAATTTTCTGAACTTGTGCAGTTCTTCAGCGATTTGTAAATTGTGAGGCCTAATTAT
TCATTTATTGTTTGTGTGCGCGTGTGTGTCTGTGAGATCGAGAGAAAGGGAGAAGAACTC
ATATTAACATAACCAATTCTTTGTATTAGAAGCTCATAAGTCGGCTAGTTTCTTGTTTGG
AATTTCATTGCAGAGAAACAAGGGCCTTGTAATTTATCACAAACTTATATGCTTGTATTA
TTCTCACACACTTTGTGGCCATTTCATGACTTC

CDS

1437 bp

>Os01t0972900-01 Similar to Clone ZZD405 mRNA sequence. (Fragment).
ATGGCGACGGACGCGTCCCCCAAGCCGGCGCCGCCGCGCCTCAACGTGCCGCCGGCGATG
GCGGGGGGGCTCCGCCTCGATCCCGCCGTCGCCTCCCCGGCCCGCCTCCTCCTCGACGTC
CCCAAGACGCCATCCCCTTCCAAGACCACGTACAGCGACCGCttcatcccctgccgctcc
tcctcccgcctccacaacttcgccctcctcgaccgcgaccgcgcctccccctcctccacc
accgacgacgccccctactcccgcctcctccgcgccgagatcttcggcccggactccccc
tccccggctccctcctcccccaacaccaacctcttccgcttcaagaccgaccacccctcg
cccaaatcgcccttcgccgcctccgccgccgccACCGCCGGCCACTACGACTGCACCGCC
GGCTCCGCTGAATCCTCCACGCCGCGCAAGCCGCCCAGGAAGGTCCCCAAGACCCCGCAC
AAGGTCCTGGACGCGCCGTCGCTGCAGGACGACTTCTACCTCAATCTTGTCGACTGGTCG
TCGCAGAACACGCTCGCCGTCGGCCTCGGGAATTGCGTCTACCTCTGGTCGGCTTCCAAT
TGCAAGGTCACCAAGCTCTGCGATTTGGGGCCCAGGGACAGCGTCTGCGCTGTGCACTGG
ACCCGAGAAGGCTCCTATCTTGCCATCGGCACCAGCCTTGGCGATGTCCAGATTTGGGAT
AGCTCTCGCTGTAAACGGATTAGGAACATGGGAGGACACCAAACACGGACTGGTGTATTA
GCATGGAGCTCCCGAATCTTGTCCTCCGGTAGCAGGGACAAGAACATATTGCAGCATGAC
ATCCGTGTCCCAAGTGACTATATCAGCAAGTTCTCAGGGCACAGATCAGAGGTCTGTGGA
CTGAAATGGTCGCACGACGACCGTGAGCTTGCATCCGGTGGAAATGATAATCAGCTGCTA
GTATGGAACCAACGTTCGCAGCAGCCGATATTGAGGCTGACAGAACACACAGCTGCAGTT
AAAGCAATAGCATGGTCACCACATCAGCAAGGCCTCCTGGCATCAGGTGGTGGAACCGCT
GATAGGTGTATCAGGTTCTGGAACACGGTTAATGGAAACATGCTGAATTCAGTGGACACA
GGCAGCCAGGTTTGTAATCTTGCCTGGTGTAAAAATGTAAATGAGCTTGTGAGCACTCAT
GGGTATTCCCAAAACCAAATCATGGTGTGGAAGTACCCATCTATGTCAAAGGTTGCTACT
CTAACTGGACACACGCTGCGAGTGCTTTACCTTGCAATGTCACCTGATGGACAGACAATA
GTAACAGGAGCCGGGGATGAAACCCTCAGATTTTGGAATATTTTTCCTTCAATGAAGACA
CAGGCTCCTGTTCGTGATATTGGGCTCTGGTCATTCTCGAGAAGCCACATACGGTGA

Protein

479 aa

>Os01t0972900-01 Similar to Clone ZZD405 mRNA sequence. (Fragment).
MATDASPKPAPPRLNVPPAMAGGLRLDPAVASPARLLLDVPKTPSPSKTTYSDRFIPCRS
SSRLHNFALLDRDRASPSSTTDDAPYSRLLRAEIFGPDSPSPAPSSPNTNLFRFKTDHPS
PKSPFAASAAATAGHYDCTAGSAESSTPRKPPRKVPKTPHKVLDAPSLQDDFYLNLVDWS
SQNTLAVGLGNCVYLWSASNCKVTKLCDLGPRDSVCAVHWTREGSYLAIGTSLGDVQIWD
SSRCKRIRNMGGHQTRTGVLAWSSRILSSGSRDKNILQHDIRVPSDYISKFSGHRSEVCG
LKWSHDDRELASGGNDNQLLVWNQRSQQPILRLTEHTAAVKAIAWSPHQQGLLASGGGTA
DRCIRFWNTVNGNMLNSVDTGSQVCNLAWCKNVNELVSTHGYSQNQIMVWKYPSMSKVAT
LTGHTLRVLYLAMSPDGQTIVTGAGDETLRFWNIFPSMKTQAPVRDIGLWSFSRSHIR*

5'UTR

chr01:42949418..42949560 (+ strand) : 143 bp

CDS

chr01:42949561..42950043 (+ strand) : 483 bp

chr01:42950152..42950379 (+ strand) : 228 bp

chr01:42950843..42951022 (+ strand) : 180 bp

chr01:42951157..42951411 (+ strand) : 255 bp

chr01:42951493..42951597 (+ strand) : 105 bp

chr01:42952019..42952081 (+ strand) : 63 bp

chr01:42952168..42952236 (+ strand) : 69 bp

chr01:42952313..42952366 (+ strand) : 54 bp

3'UTR

chr01:42952367..42952679 (+ strand) : 313 bp

FASTA

>Os01t0972900-01 class=Sequence position=chr01:42949418..42952679 (+ strand)
TGACCGTTGC AACCTCATCT CCGCTCCTCT TCCTcctcct cgtcgtcgtt gtcgtcgtcg gcggcgcatc cagcctcgac
gtgccggcgG CGGTGGGTGG CGGGGCAGCA GACGAGCAAG AAAGAGATCC CTAGTCTCTC TCGATGGCGA CGGACGCGTC
CCCCAAGCCG GCGCCGCCGC GCCTCAACGT GCCGCCGGCG ATGGCGGGGG GGCTCCGCCT CGATCCCGCC GTCGCCTCCC
CGGCCCGCCT CCTCCTCGAC GTCCCCAAGA CGCCATCCCC TTCCAAGACC ACGTACAGCG ACCGCttcat cccctgccgc
tcctcctccc gcctccacaa cttcgccctc ctcgaccgcg accgcgcctc cccctcctcc accaccgacg acgcccccta
ctcccgcctc ctccgcgccg agatcttcgg cccggactcc ccctccccgg ctccctcctc ccccaacacc aacctcttcc
gcttcaagac cgaccacccc tcgcccaaat cgcccttcgc cgcctccgcc gccgccACCG CCGGCCACTA CGACTGCACC
GCCGGCTCCG CTGAATCCTC CACGCCGCGC AAGCCGCCCA GGAAGGTCCC CAAGACCCCG CACAAGGTGG GTTCCCAACG
TTCCTTCTTC CCTCTTCTTG GGCATTTCCA CAAACACCCA CTGCGCAACT AAAACAATCT TTTGGTTTCC GATCCGTGTG
CGTGCGCAAC TCAGGTCCTG GACGCGCCGT CGCTGCAGGA CGACTTCTAC CTCAATCTTG TCGACTGGTC GTCGCAGAAC
ACGCTCGCCG TCGGCCTCGG GAATTGCGTC TACCTCTGGT CGGCTTCCAA TTGCAAGGTC ACCAAGCTCT GCGATTTGGG
GCCCAGGGAC AGCGTCTGCG CTGTGCACTG GACCCGAGAA GGCTCCTATC TTGCCATCGG CACCAGCCTT GGCGATGTCC
AGGTTTCCCC CTCTCATCTC CTCTCCTCTA CTCTCTACTG AATAAATTGC CTGCAGCATA TGATTGTCTT CAGTTTATCT
ATCTAGTACT TAGTAGTAAT TGTTTTCTAC ACTCTTTAGA TTTCATCACA ACAATTACAC AAACTATATA CATCAATTGT
TCCAAATATC CTGAATCCTG GGCTGATGCA ATTCGCTTCG TTCACCATCT CGTATGATAG ATGTACACTA GTAAAGATTT
GAAACATAAG CCCTATTGCT GAAACTCTAA ACTTTTATTC GATTCTAGTA CTAACTATCA CTATCACAAC ACGTACATAC
TTCTTTCAAT GTGTCCAGGA TGTGTGCGAC AGTTTTGTCT GCAAATCTCA AACTACCTAT ACTTGAATTA GCCTATTGTT
TTTGTTCAAC TCTGTGAATT TGTTCATGGC TATCGAGAAT TTGATGCATA CATAAATTCC AACAGATTTG GGATAGCTCT
CGCTGTAAAC GGATTAGGAA CATGGGAGGA CACCAAACAC GGACTGGTGT ATTAGCATGG AGCTCCCGAA TCTTGTCCTC
CGGTAGCAGG GACAAGAACA TATTGCAGCA TGACATCCGT GTCCCAAGTG ACTATATCAG CAAGTTCTCA GGGCACAGAT
CAGAGGTGAG ACTTCTAACT ACTTCCAAGC CATAGGTTTT TGGAAAATAG CTCACTAACT ATGCAAGTTA AAATCATCCC
ATCTCACAGT AAGATTTCAG AACCATGTAT GTGCATCAAG TGACAGTTTT TTTGGTCAGG TCTGTGGACT GAAATGGTCG
CACGACGACC GTGAGCTTGC ATCCGGTGGA AATGATAATC AGCTGCTAGT ATGGAACCAA CGTTCGCAGC AGCCGATATT
GAGGCTGACA GAACACACAG CTGCAGTTAA AGCAATAGCA TGGTCACCAC ATCAGCAAGG CCTCCTGGCA TCAGGTGGTG
GAACCGCTGA TAGGTGTATC AGGTTCTGGA ACACGGTTAA TGGAAACATG CTGAATTCAG TGGACACAGG CAGCCAGGCG
AGTAGTTCTG AACAAGCCTC TAAAAAGTAG TTCAGTGAAT TTTTACTGTC ATCCTCACCA GCTGCTTTCT GTTTTCAGGT
TTGTAATCTT GCCTGGTGTA AAAATGTAAA TGAGCTTGTG AGCACTCATG GGTATTCCCA AAACCAAATC ATGGTGTGGA
AGTACCCATC TATGTCAAAG GTAAGCTTAA ATTCCCGTGG GCTGTCAAGC CTACTAATTC ACCAGTTAGA CAATTGTGCA
TCAAGTAATC ACTCATTCGG ATAAAAACGT GAAAAAAAGC AGAGGAAGTT ATGTGTCTGA TTTCTCCTAG GGTTGTTTCC
AAAGAACTCA TTCCTTTCTG TGGGCCGAGA CATTGACTCA TGGATTGCTT AAACGCTTAA AAGGAATTTA GTATCAACAT
AGTTGACGAG CATGTAATGC TTAAAAAGAA CAATATCAGT ATGGCTGCAA ATCCAAGTGA AGTATTTCAC AGGGGGCTAT
TTTCATTTGT ATTTGCAGAT AAGGATAAGA GTAGAATAAT TCCTTTGAAT TTTTAATATC TGTTCAAGAA AGATTTCCAC
TAGTGCAGTA CCACTAAGTA TTTTATGTTT TCGATAAACA GGTTGCTACT CTAACTGGAC ACACGCTGCG AGTGCTTTAC
CTTGCAATGT CACCTGATGG ACAGGTAAAT CTTTTTCCAA ACTGCAAATC ATGTATCCGG AAAAATATTC CTGGGAATCG
TCCTAAATGA TGCATATTAC TCATTTGCAG ACAATAGTAA CAGGAGCCGG GGATGAAACC CTCAGATTTT GGAATATTTT
TCCTTCAATG AAGACACAGG TAGGCATCTA TTGTTGAACA CAGATTTTAT TTATTTTGTG GCTTGTAGCT TGAACTGCCA
TATTGTTTGC ACCAGGCTCC TGTTCGTGAT ATTGGGCTCT GGTCATTCTC GAGAAGCCAC ATACGGTGAC CATAATAGGA
GGCAAAGAAA ATGCATATGT TTGTATGAAA CATAATTTTC TGAACTTGTG CAGTTCTTCA GCGATTTGTA AATTGTGAGG
CCTAATTATT CATTTATTGT TTGTGTGCGC GTGTGTGTCT GTGAGATCGA GAGAAAGGGA GAAGAACTCA TATTAACATA
ACCAATTCTT TGTATTAGAA GCTCATAAGT CGGCTAGTTT CTTGTTTGGA ATTTCATTGC AGAGAAACAA GGGCCTTGTA
ATTTATCACA AACTTATATG CTTGTATTAT TCTCACACAC TTTGTGGCCA TTTCATGACT TC

Locus: Os01g0972900

Loading...

Locus: Os01g0972900

Loading...