Os02t0102300-01

Locus

Os02g0102300

Description

Arsenate reductase, Sulfurtransferase/rhodanese-like protein, Regulation of arsenic accumulation

RAP-DB Gene Symbol Synonym(s)

STR5, OsHAC1;1, OsStr5

RAP-DB Gene Name Synonym(s)

SULFURTRANSFERASE 5, Sulfurtransferase 5

CGSNL Gene Symbol

STR5

CGSNL Gene Name

SULFURTRANSFERASE 5

Oryzabase Gene Symbol Synonym(s)

OsStr5, OsHAC1;1, HAC1;1

Oryzabase Gene Name Synonym(s)

Sulfurtransferase 5, High As Content 1;1

Transcript Evidence

AK067143

Protein Evidence

Q0E4S8

Q6YU82

Literature

PMID: 27702843

PMID: 21821426

Note

Manual Curation

November 7, 2016

Functional domain (InterPro)

Rhodanese-like domain (IPR001763)

Full-length cDNA

J013095M22 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0102300-01)

RiceXPro (AK067143)

Others

Oryzabase (12055)

KEGG (Os02t0102300-01 (EC:2.8.1.1))

Transcript

863 bp

>Os02t0102300-01 Arsenate reductase, Sulfurtransferase/rhodanese-like protein, Regulation of arsenic accumulation
GTGCATCTCGCTACCTAACCTAGCTAACCTCCTCTCTTCTTCTTCTTCTTCTTCTTCTTC
TTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTTCTAGGCTAGCACTGCACGTGCCCAA
CTAACACATACATTCATCATATATACACCTCCTCCTCCTTCTTCCTCTAAGTTGTGTGTG
CATATATAATCTACTAGTAGAGAGCAGGGCTAGGCTAGCAATTGCAATGGCGCCTCCCTA
TGAAACCAGCGCCGCCGGCTCTGAATCGCCGGTGCCGGTGGTAACGGTGGATGTGGCGGC
GGCGAGCGACCTTATCACCTCGGCCGGCCACCGTTACGTCGACGTCAGGACAGAGGAGGA
AATGAACAAGGGCCATCTACACAACTCCCTCAACGTGCCCTTCATGTTCGTCACGCCGCA
AGGCAAGGAAAAGAATCCTCTGTTTGTGGAGCAGTTCTCGTCGCTGGTGAGCAAAGAGGA
GCATGTGGTTGTGGGGTGCCAAAGCGGGAAGAGGTCGGAGCTAGCATGCGTTGATCTCCT
TGAAGCAGGGTTCAAGAACGTGAAGAACATGGGAGGAGGCTACGCAGCGTGGCTCGACAA
TGGATTCCCCATAAACACTCCTCCTCATACAATGTATTAACGCTTTGCAGCACCGATGAG
ATGAGCGAGTGATAAACACGGACTCTACTGTATCTACTGTATCTCATTCCAACCCCTCTT
CTCATCTGCCTGCTAGCCGCTGCTTCGTGTGCCCTGCCATGTATATGTATGTGCGTCCTG
TTTTCCTGTTTGTTACTACTGGTATTATGGAGGCAGCCAATTGAATAAAATTGATCATCA
TGCATGCAATGCACGATGCGTCT

CDS

414 bp

>Os02t0102300-01 Arsenate reductase, Sulfurtransferase/rhodanese-like protein, Regulation of arsenic accumulation
ATGGCGCCTCCCTATGAAACCAGCGCCGCCGGCTCTGAATCGCCGGTGCCGGTGGTAACG
GTGGATGTGGCGGCGGCGAGCGACCTTATCACCTCGGCCGGCCACCGTTACGTCGACGTC
AGGACAGAGGAGGAAATGAACAAGGGCCATCTACACAACTCCCTCAACGTGCCCTTCATG
TTCGTCACGCCGCAAGGCAAGGAAAAGAATCCTCTGTTTGTGGAGCAGTTCTCGTCGCTG
GTGAGCAAAGAGGAGCATGTGGTTGTGGGGTGCCAAAGCGGGAAGAGGTCGGAGCTAGCA
TGCGTTGATCTCCTTGAAGCAGGGTTCAAGAACGTGAAGAACATGGGAGGAGGCTACGCA
GCGTGGCTCGACAATGGATTCCCCATAAACACTCCTCCTCATACAATGTATTAA

Protein

138 aa

>Os02t0102300-01 Arsenate reductase, Sulfurtransferase/rhodanese-like protein, Regulation of arsenic accumulation
MAPPYETSAAGSESPVPVVTVDVAAASDLITSAGHRYVDVRTEEEMNKGHLHNSLNVPFM
FVTPQGKEKNPLFVEQFSSLVSKEEHVVVGCQSGKRSELACVDLLEAGFKNVKNMGGGYA
AWLDNGFPINTPPHTMY*

5'UTR

chr02:124645..124870 (+ strand) : 226 bp

CDS

chr02:124871..124893 (+ strand) : 23 bp

chr02:125030..125128 (+ strand) : 99 bp

chr02:125379..125456 (+ strand) : 78 bp

chr02:125854..125920 (+ strand) : 67 bp

chr02:126038..126091 (+ strand) : 54 bp

chr02:126816..126908 (+ strand) : 93 bp

3'UTR

chr02:126909..127131 (+ strand) : 223 bp

FASTA

>Os02t0102300-01 class=Sequence position=chr02:124645..127131 (+ strand)
GTGCATCTCG CTACCTAACC TAGCTAACCT CCTCTCTTCT TCTTCTTCTT CTTCTTCTTC TTCTTCTTCT TCTTCTTCTT
CTTCTTCTTC TTCTTCTAGG CTAGCACTGC ACGTGCCCAA CTAACACATA CATTCATCAT ATATACACCT CCTCCTCCTT
CTTCCTCTAA GTTGTGTGTG CATATATAAT CTACTAGTAG AGAGCAGGGC TAGGCTAGCA ATTGCAATGG CGCCTCCCTA
TGAAACCAGG TCAGTCAGAT CAGAATTATA TATATTTATG TACTAATTCA TGACCTGCTA GCAACTAGAT AGTAAAAGAG
TTATAATCTA TATATATGAA GAAATTGAAA TCTCGGTATA TATGTATCTG CCTTAATGCA TGCAGCGCCG CCGGCTCTGA
ATCGCCGGTG CCGGTGGTAA CGGTGGATGT GGCGGCGGCG AGCGACCTTA TCACCTCGGC CGGCCACCGT TACGTCGACG
TCAGGTACTA CTACCTATCT GTCTGTCTGT CTTTGCATCC TCCCCTAGCT ATATCTATCG ATATCATGTA GGAGTATATG
AATATCAGGA TATATATGAT CCATCCTTAA TTAATTTCTT CATGCATGAG CAACGAGAGC ATATATATAT ACCTCCTAAT
TAATTTGTTG GAGAAATGAA ATTACAGCAC ATGCATGACT ATGTGTGCTG GTATCTTCGT CTGATTGATA GAGCAATTAA
ACATGATTAT GCAGGACAGA GGAGGAAATG AACAAGGGCC ATCTACACAA CTCCCTCAAC GTGCCCTTCA TGTTCGTCAC
GCCGCAAGGC AAGTCAGCCA GCCGATTAAT TCACTTTAAT CTGTCCAGAT TTTTACACCA TTTTTCATCG TCGTCCAAAT
AACTAGCGTA ATCAATATAT ATACTCTTAT GATTCAATAC TAGTACTTTA AGAATTTGGA ACAAGAAATT CTGTCTACAC
ATATCGATCT CGTTCTCGCT CAAACATATC CATCCACTCC TATCATTTTC ATGAATAGTA ATTTCCCACT ACAAAACGAT
ATACTACTAT ATGCATGATG CTTCTGGTTG TTGGGTTGTG TCTGTACCTG GGCATGTTGA GCATCTGATT TATGAACGTG
GACGTGTGCT CGTCCAGGTA CATACGGGGG GAGTAATTAA CAAGCATGAT TATATTTATG AGCGTTATTA TCATCCATGT
TGCAGGGAGG GAAAAGAATC CTCTGTTTGT GGAGCAGTTC TCGTCGCTGG TGAGCAAAGA GGAGCATGTG GTTGTGGTAC
GATACGAATT AAAATTAAAA TTCCCCAAAA AAATATTTAT TTGACAAGAA ATAATATATG TGCTCGATCT AATTGACGAA
CCTTGTAATA AAAATAAACA ATCCAACTAT TAGGGGTGCC AAAGCGGGAA GAGGTCGGAG CTAGCATGCG TTGATCTCCT
TGAAGCAGTA AGTTTGATGT TTTTAATCAA ACACGTACTA GTTGCACTTG TACTTGATCG ACCATCATCT CTCTCTACGT
TTCTCATTGC CTTGTTGATG GCTCTGTCTC TTGTTccctg tttacttccc acacacaaaa aaaaaattac accatatcac
atagaacatt tgaacacata catacatgat taaatatagg ctaaaaaaac aactaattac gcagattgtg actaatttgc
gagacaaatc ttttaaactt aatttctcca tgatttcaca atgtgggcta caataaacat ttgctaatga tgggttaaat
aggctaaatt cgtctcacgg tttactgacg tattctataa ttagtttttt tattagtgcc caaacaccca tgcgatacct
tttataatac ccgatgtgac acgccaaaac tttacacatt tgaatctaaa cactccctTA ATATACATAC AGTGAAACAA
ATAAAGTAAA GGAAGACGGG ACAGGTCATG ATTCAtactc ctcgtctaaa aaaatgaata tataactgga tgtaacatat
tgtagtataa cgaatctgaa caacgatata ttcagattca taatattaaa atgtttcaca tccagtttta gattgatttt
ttATAGAATA GATTGGTTTT TTATGGAACG GAGGGAGAGT ACGAGTGAGT TGTAACATGA CTGACATACA GTATATATGT
ATCTGCAACA GGGGTTCAAG AACGTGAAGA ACATGGGAGG AGGCTACGCA GCGTGGCTCG ACAATGGATT CCCCATAAAC
ACTCCTCCTC ATACAATGTA TTAACGCTTT GCAGCACCGA TGAGATGAGC GAGTGATAAA CACGGACTCT ACTGTATCTA
CTGTATCTCA TTCCAACCCC TCTTCTCATC TGCCTGCTAG CCGCTGCTTC GTGTGCCCTG CCATGTATAT GTATGTGCGT
CCTGTTTTCC TGTTTGTTAC TACTGGTATT ATGGAGGCAG CCAATTGAAT AAAATTGATC ATCATGCATG CAATGCACGA
TGCGTCT