Os02t0102900-01

Locus

Os02g0102900

Description

Similar to RuBisCO subunit binding-protein beta subunit, chloroplast (60 kDa chaperonin beta subunit) (CPN-60 beta) (Fragment).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsCPn60beta2, OsCPn60b2

Oryzabase Gene Name Synonym(s)

chaperonin 60 beta subunit 2, chaperonin 62.5K beta-chain

Transcript Evidence

AK070603 (DDBJ, Best hit)

AK101537 (DDBJ, Best hit)

Protein Evidence

B6THN2 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein folding (GO:0006457)

Biological Process: protein refolding (GO:0042026)

Biological Process: cellular protein metabolic process (GO:0044267)

Cellular Component: cytoplasm (GO:0005737)

Molecular Function: ATP binding (GO:0005524)

Functional domain (InterPro)

Chaperonin Cpn60 (IPR001844)

Chaperonin Cpn60/TCP-1 (IPR002423)

Chaperonin Cpn60, conserved site (IPR018370)

Full-length cDNA

J023059D06 (Online Clone Ordering)

J033048E22 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0102900-01)

Others

Oryzabase (14351)

Transcript

2309 bp

>Os02t0102900-01 Similar to RuBisCO subunit binding-protein beta subunit, chloroplast (60 kDa chaperonin beta subunit) (CPN-60 beta) (Fragment).
ATTGATTGAGCAGCCGGCGGCGGCGATCTTTGCTTAAACCCTAATCTCAGACGCTGCCTT
TGAGAGAGGAGAGGGGGGAGATCTTCTTCTTCGCTTACGGCGGGTGCAGACAATATGGCC
TCAGCATTCGGGAGCACCTCAGCATGTGGCATCAAGATCACTCCTACCGCTTTTGCCACC
AAGAAACATCTTTGCCTGGTTCCACCCCCAGTCGTTTCACTTCCCCGGAAAAATAGGCCT
CAGAGGAAGTGTAATTTCAGAGTAAATGCTGCCAAAGAGTTATATTTCAACAAGGATGGG
TTGGCTATCAAGAAGCTGCAAAATGGAGTCAATAAGCTTGCTGATCTCGTTGGAGTCACC
CTTGGTCCAAAAGGACGGAATGTTGTCCTTGAGAGCAAGTATGGATCACCTAAAATTGTC
AATGATGGTGTTACCGTTGCAAAGGAGGTTGAGCTGGAGGACCCTGTTGAAAATATTGGA
GCCAAATTAGTCCGGCAAGCTGCAGCCAAGACAAATGATTTGGCTGGTGATGGGACAACG
ACTTCTGTTGTCCTTGCTCAAGGGATGATCACAGAGGGTGTTAAGGTTGTGGCTGCTGGT
GCTAATCCAGTACAGATTACCCGTGGTATAGAGAAAACGGCCAAAGCACTTGTGAGTGAA
CTCCAAAAAATGTCCAAGGAGGTTGAAGACAGCGAACTTGCTGATGTTGCTGCGGTAAGT
GCTGGAAATAACTACGAAATTGGCAACATGATAGCTGAAGCTATGAACAAGGTTGGACGA
CAGGGGGTGGTCACACTTGAAGAAGGAAAGAGTGCTGAAAATAATCTCTATGTTGTTGAG
GGAATGCAATTTGATCGCGGCTATATTTCTCCCTACTTTGTAACTGACAGTGAAAAAATG
TCAGTGGAGTATGAGAATTGCAAGTTGCTCCTTGTGGACAAGAAAATCAACAATGCCAGA
GATCTTATAACAATTCTGGAGGATGCTATTAGGGGTGGGTACCCAATCCTAATAGTTACG
GAGGATATTGAGCAGGAAGCTCTTGCAACTCTTGTGGTCAACAGGCTTAGGGGTGCATTG
AAGATTGCTGCTATTAAAGCTCCTGGTTTTGGAGAACGCAAGAGTCAATACCTTGATGAT
ATTGCTACTCTTACTGGAGGTACTGTCATCAGGGAAGAAGTTGGCTTGTCCCTAGACAAA
GCTGATAGAGATGTTCTAGGAACGGCCGCCAAGGTTGTAGTTACCAAGGATTCAACAACA
ATAGTTGGGGATGGTACTACCCAGGACGAAGTAAACAAAAGGGTGACACAAATCAAGAAC
CAGATTGAGGTTGCTGAACAGGAATATGAGAAAGAAAAACTGAATGAGAGAATAGCTAAG
CTCTCTGGTGGTGTTGCTGTCATCCAGGTAGGAGCACAGACAGAAACTGAGCTTAAGGAA
AAGAAACTGAGGGTTGAAGATGCACTGAATGCAACCAAGGCGGCTGTTGAGGAAGGTATT
GTTGTTGGAGGTGGCTGTACGCTTTTGCGGCTTGCATCAAAAGTTGATGCCATTATAGAA
ACACTTGAGAATGATGAACAGAAGGTTGGGGCTGAAATCGTAAGGAAGTCCTTGAGTTAC
CCACTTAAATTAATAGCAAAAAATGCTGGTGTTAACGGCAGTGTTGTTACTGAGAAGGTC
CTTGCCAATGATAACTTCAGGTATGGTTACAATGCCGCTACAGGAAAATATGAGGATTTG
ATGGCTGCTGGTATTATTGATCCCACCAAGGTGGTGAGATGTTGCTTGGAGCATGCTGCG
TCGGTGGCGAAAACATTCATCACATCAGATGCTGTTGTGGTGGACATCAAGGAGCCTGAG
AAAGCAGCTGCTGCTGGGAACCCAATGGGTGGATCAGGTTTTGGATTTTAGTTTAGAAGA
AGAGGAGTACCCTTTTTGGCAGTTGGCAACCATTTTTACACTGGAGGCAGGCAGAATTTC
ACAGTTGCATCTGAGACGTTTTTTCTTTTCCTGTGTGTAATTGTTGCGTACGTCAATGTG
GCAGATGAGAGGAGTAGTAGGTTATGAATGGCCAGCATTATGACAGTTTATTGTTGCTCG
ACCTTACAGAAGAGCTGAAACAGTGCAACATAATGTTTTTAAGGTTGAGAATTATGCAAG
CTGAAGTAGTTGGTAATAACCGGGAGAGGATTGTGTTGTCGTTGGAGTAGATGATGATTT
TACTAGCTAGTTAGATCGAGTTACAAACATATAATTAATTAATTAAGGGGGCATTGGCAG
ATTACAATAATAAATAAATTATTTACATG

CDS

1797 bp

>Os02t0102900-01 Similar to RuBisCO subunit binding-protein beta subunit, chloroplast (60 kDa chaperonin beta subunit) (CPN-60 beta) (Fragment).
ATGGCCTCAGCATTCGGGAGCACCTCAGCATGTGGCATCAAGATCACTCCTACCGCTTTT
GCCACCAAGAAACATCTTTGCCTGGTTCCACCCCCAGTCGTTTCACTTCCCCGGAAAAAT
AGGCCTCAGAGGAAGTGTAATTTCAGAGTAAATGCTGCCAAAGAGTTATATTTCAACAAG
GATGGGTTGGCTATCAAGAAGCTGCAAAATGGAGTCAATAAGCTTGCTGATCTCGTTGGA
GTCACCCTTGGTCCAAAAGGACGGAATGTTGTCCTTGAGAGCAAGTATGGATCACCTAAA
ATTGTCAATGATGGTGTTACCGTTGCAAAGGAGGTTGAGCTGGAGGACCCTGTTGAAAAT
ATTGGAGCCAAATTAGTCCGGCAAGCTGCAGCCAAGACAAATGATTTGGCTGGTGATGGG
ACAACGACTTCTGTTGTCCTTGCTCAAGGGATGATCACAGAGGGTGTTAAGGTTGTGGCT
GCTGGTGCTAATCCAGTACAGATTACCCGTGGTATAGAGAAAACGGCCAAAGCACTTGTG
AGTGAACTCCAAAAAATGTCCAAGGAGGTTGAAGACAGCGAACTTGCTGATGTTGCTGCG
GTAAGTGCTGGAAATAACTACGAAATTGGCAACATGATAGCTGAAGCTATGAACAAGGTT
GGACGACAGGGGGTGGTCACACTTGAAGAAGGAAAGAGTGCTGAAAATAATCTCTATGTT
GTTGAGGGAATGCAATTTGATCGCGGCTATATTTCTCCCTACTTTGTAACTGACAGTGAA
AAAATGTCAGTGGAGTATGAGAATTGCAAGTTGCTCCTTGTGGACAAGAAAATCAACAAT
GCCAGAGATCTTATAACAATTCTGGAGGATGCTATTAGGGGTGGGTACCCAATCCTAATA
GTTACGGAGGATATTGAGCAGGAAGCTCTTGCAACTCTTGTGGTCAACAGGCTTAGGGGT
GCATTGAAGATTGCTGCTATTAAAGCTCCTGGTTTTGGAGAACGCAAGAGTCAATACCTT
GATGATATTGCTACTCTTACTGGAGGTACTGTCATCAGGGAAGAAGTTGGCTTGTCCCTA
GACAAAGCTGATAGAGATGTTCTAGGAACGGCCGCCAAGGTTGTAGTTACCAAGGATTCA
ACAACAATAGTTGGGGATGGTACTACCCAGGACGAAGTAAACAAAAGGGTGACACAAATC
AAGAACCAGATTGAGGTTGCTGAACAGGAATATGAGAAAGAAAAACTGAATGAGAGAATA
GCTAAGCTCTCTGGTGGTGTTGCTGTCATCCAGGTAGGAGCACAGACAGAAACTGAGCTT
AAGGAAAAGAAACTGAGGGTTGAAGATGCACTGAATGCAACCAAGGCGGCTGTTGAGGAA
GGTATTGTTGTTGGAGGTGGCTGTACGCTTTTGCGGCTTGCATCAAAAGTTGATGCCATT
ATAGAAACACTTGAGAATGATGAACAGAAGGTTGGGGCTGAAATCGTAAGGAAGTCCTTG
AGTTACCCACTTAAATTAATAGCAAAAAATGCTGGTGTTAACGGCAGTGTTGTTACTGAG
AAGGTCCTTGCCAATGATAACTTCAGGTATGGTTACAATGCCGCTACAGGAAAATATGAG
GATTTGATGGCTGCTGGTATTATTGATCCCACCAAGGTGGTGAGATGTTGCTTGGAGCAT
GCTGCGTCGGTGGCGAAAACATTCATCACATCAGATGCTGTTGTGGTGGACATCAAGGAG
CCTGAGAAAGCAGCTGCTGCTGGGAACCCAATGGGTGGATCAGGTTTTGGATTTTAG

Protein

599 aa

>Os02t0102900-01 Similar to RuBisCO subunit binding-protein beta subunit, chloroplast (60 kDa chaperonin beta subunit) (CPN-60 beta) (Fragment).
MASAFGSTSACGIKITPTAFATKKHLCLVPPPVVSLPRKNRPQRKCNFRVNAAKELYFNK
DGLAIKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGSPKIVNDGVTVAKEVELEDPVEN
IGAKLVRQAAAKTNDLAGDGTTTSVVLAQGMITEGVKVVAAGANPVQITRGIEKTAKALV
SELQKMSKEVEDSELADVAAVSAGNNYEIGNMIAEAMNKVGRQGVVTLEEGKSAENNLYV
VEGMQFDRGYISPYFVTDSEKMSVEYENCKLLLVDKKINNARDLITILEDAIRGGYPILI
VTEDIEQEALATLVVNRLRGALKIAAIKAPGFGERKSQYLDDIATLTGGTVIREEVGLSL
DKADRDVLGTAAKVVVTKDSTTIVGDGTTQDEVNKRVTQIKNQIEVAEQEYEKEKLNERI
AKLSGGVAVIQVGAQTETELKEKKLRVEDALNATKAAVEEGIVVGGGCTLLRLASKVDAI
IETLENDEQKVGAEIVRKSLSYPLKLIAKNAGVNGSVVTEKVLANDNFRYGYNAATGKYE
DLMAAGIIDPTKVVRCCLEHAASVAKTFITSDAVVVDIKEPEKAAAAGNPMGGSGFGF*

5'UTR

chr02:158662..158770 (+ strand) : 109 bp

chr02:159590..159594 (+ strand) : 5 bp

CDS

chr02:159595..159801 (+ strand) : 207 bp

chr02:159892..160017 (+ strand) : 126 bp

chr02:160201..160338 (+ strand) : 138 bp

chr02:160431..160526 (+ strand) : 96 bp

chr02:160958..161200 (+ strand) : 243 bp

chr02:161303..161537 (+ strand) : 235 bp

chr02:161612..161781 (+ strand) : 170 bp

chr02:161975..162052 (+ strand) : 78 bp

chr02:162156..162227 (+ strand) : 72 bp

chr02:162345..162449 (+ strand) : 105 bp

chr02:162555..162647 (+ strand) : 93 bp

chr02:162737..162829 (+ strand) : 93 bp

chr02:163109..163235 (+ strand) : 127 bp

chr02:163317..163330 (+ strand) : 14 bp

3'UTR

chr02:163331..163728 (+ strand) : 398 bp

FASTA

>Os02t0102900-01 class=Sequence position=chr02:158662..163728 (+ strand)
ATTGATTGAG CAGCCGGCGG CGGCGATCTT TGCTTAAACC CTAATCTCAG ACGCTGCCTT TGAGAGAGGA GAGGGGGGAG
ATCTTCTTCT TCGCTTACGG CGGGTGCAGG TATCCCATCC AATCCATCTT CCCCTCACCT CTCTCCCTCT CTCTCTTATA
CAGGTTAGAT TGGACGACAT TCCATCAAGA ATGTTAGTTA AAACAATGTC AATGATGGAT GGATCGAATA AGAGGAATAT
AGATTAGCTG CGATTGACCG CGATGGATCA ATCAAATTCA ATCCATCGAT TTTTTCCCCT CGAGTATTTT GGTGGTCATC
TTCATTCGAT CTGGCGTTCA AGGCCAAGTT TTGCACTTTT CATCTTGTCT CACAGATTTG ATCGCTCAAC TTCTCTTCTA
AAACATCCTC CTTTACCTAC CTACTTCCTC ATCTCCCTGA TTTTCCCTGC TTCCTCTTTT TGCCGCTATT CCCCTCCCCT
CTCCTCTCCT CTCCTTGCAG AACTTGTTTT TTTTTTTTAA AAAAAATCAT CTCCCTTTTA TTTTCTTGTA GACAAGCAGT
GTAGAGCCCT GGTGCTACTC TGTTAGAGCC AATCTTACAG ATCATGGATG GATGCGAATG CTATTGACCA GTCTCGGTCA
AACTCAAATT AATCACTACA TATATATATG CCACAACACT TGAAACAAAT TACTTCAACT TTTCAACCAT CTATTTTTCC
CTATATATGC CTGTACTAGT ATGACTGCTT TTCCTTGCAA AGTAATTGTA ACCTGTTCTA GCAACTAGAA ACTTCTTTTC
TGTCTGCTTA GTTTGCCAAA GGTCTCTTTC AAGCATTTTT TTTTTTAAAT CAGAGTTTCT TCTTCCTCTG TTTTCTCCCT
TCTTGTGTTC ACTCATGCTG ATGTAGTCTG GCAACTTCTC TGCAACAGAC AATATGGCCT CAGCATTCGG GAGCACCTCA
GCATGTGGCA TCAAGATCAC TCCTACCGCT TTTGCCACCA AGAAACATCT TTGCCTGGTT CCACCCCCAG TCGTTTCACT
TCCCCGGAAA AATAGGCCTC AGAGGAAGTG TAATTTCAGA GTAAATGCTG CCAAAGAGTT ATATTTCAAC AAGGATGGGT
TGGCTATCAA GAAGCTGCAA GTGAGTTGTA CATTCTAATA ATTTCTACTA GCATGATGCT ATCATCTATA ACATCAACTT
CTGAGTTGTG ACTTCTATTT TCTATGACAG AATGGAGTCA ATAAGCTTGC TGATCTCGTT GGAGTCACCC TTGGTCCAAA
AGGACGGAAT GTTGTCCTTG AGAGCAAGTA TGGATCACCT AAAATTGTCA ATGATGGTGT TACCGTTGCA AAGGAGGTAT
GCCACGTATA GTAAACTGTT CGTGTTCTTA TGATGCAATC CTATCATTGC TTAAATTCAG AGTTTTCTGA AAAATGACTG
AACATTTGGC ATAAACTGTT TGTTTTCTTA TGATGCAATC CTATCATAGC TTAAATTCAG AGTTTTCTGA AAAATGAGTG
AACATTTGGC ATGCACCAGG TTGAGCTGGA GGACCCTGTT GAAAATATTG GAGCCAAATT AGTCCGGCAA GCTGCAGCCA
AGACAAATGA TTTGGCTGGT GATGGGACAA CGACTTCTGT TGTCCTTGCT CAAGGGATGA TCACAGAGGG TGTTAAGGTA
CACCAATATA AAAGCCTTGT ATCTTAATTT TACAGCATAA ATATTTTACT TGGTTCTGGG AACAATCGTG GATCTGTTTA
CTTTCCCAGG TTGTGGCTGC TGGTGCTAAT CCAGTACAGA TTACCCGTGG TATAGAGAAA ACGGCCAAAG CACTTGTGAG
TGAACTCCAA AAAATGTCCA AGGAGGTAAG TTATGGACTT CTGTTTAAGA TCTTATTCTT TTCTGCAACA AATCACTATA
CTCCGCTAGT CATGTAATGC AGCCAAAATA GGGTGTGCCA TACATGAGAT ACTTCTATAG TCCTATATAC AATATACAAC
TCTATGAAAA AGTTAACGTG GTTCTCACTT GCCCATTTGT AAATTTGTAA ATCAACTGGA TTTGTATATA CGTAGCTAAG
TCTAATGATT TTGATATGAG TGGTGTATAG TGTGCCATGT TTCACGTTTC TTTTTCAGTA ATACTAAACA TGAGTGCTGG
GAATCTTCTG TGCTGATATT TAAGTAACAC CCATTTGAAT TCAGGAGCAT TGGCTGCCAG TTTGAATCGT ACTCATCCGC
TACAGCACTA TTTTTGCTTG AAATTTGAAT CTATCATATT GCATGCAACT TTGCAGGTTG AAGACAGCGA ACTTGCTGAT
GTTGCTGCGG TAAGTGCTGG AAATAACTAC GAAATTGGCA ACATGATAGC TGAAGCTATG AACAAGGTTG GACGACAGGG
GGTGGTCACA CTTGAAGAAG GAAAGAGTGC TGAAAATAAT CTCTATGTTG TTGAGGGAAT GCAATTTGAT CGCGGCTATA
TTTCTCCCTA CTTTGTAACT GACAGTGAAA AAATGTCAGT GGAGTATGAG AATTGCAAGG TTTGATGCAT TCTAGAATTC
GGTGTACTTA AACTGTGCAT TAACCAGATA CTCATTTGTG GGCTCTATGC ATTTGATGCT AATGTTGATT CTATCACCCA
GTTGCTCCTT GTGGACAAGA AAATCAACAA TGCCAGAGAT CTTATAACAA TTCTGGAGGA TGCTATTAGG GGTGGGTACC
CAATCCTAAT AGTTACGGAG GATATTGAGC AGGAAGCTCT TGCAACTCTT GTGGTCAACA GGCTTAGGGG TGCATTGAAG
ATTGCTGCTA TTAAAGCTCC TGGTTTTGGA GAACGCAAGA GTCAATACCT TGATGATATT GCTACTCTTA CTGGAGGTGA
TATTCAGCTT TTGACATAAG TTGTCTACAC TCTAAGCCAC ACGTGCGCTT ATATATCGTT CTTCTTTCAG GTACTGTCAT
CAGGGAAGAA GTTGGCTTGT CCCTAGACAA AGCTGATAGA GATGTTCTAG GAACGGCCGC CAAGGTTGTA GTTACCAAGG
ATTCAACAAC AATAGTTGGG GATGGTACTA CCCAGGACGA AGTAAACAAA AGGGTGACAC AAATCAAGAA CCAGATTGAG
GTCTGTATTA TTTAAAATTA AAAATTCTAT GTGTTCCTGT ACTTCTCGTC AAACCACTCC TGTATTCATT TTCTCCTGAC
CCTGCTCTTT TTTGGGGGTT TCTTTGCTTA CATGAATTTA CAGGGCAGAT CTTTTGGATT CACATGTCTC AGTATTTTTT
TGTGGATTTT TATACAAGTT ATTTTTTCTT CAGGTTGCTG AACAGGAATA TGAGAAAGAA AAACTGAATG AGAGAATAGC
TAAGCTCTCT GGTGGTGTTG CTGTCATCCA GGTGATCTCG ATGTTCTGCA ATTGAACCAA TGCACTTGTT AATGTACTAC
TAGGCTGCAT TTGCAGAAGA TAATTGTTGT GAAATGACGC TACTTGTTAT GTAGGTAGGA GCACAGACAG AAACTGAGCT
TAAGGAAAAG AAACTGAGGG TTGAAGATGC ACTGAATGCA ACCAAGGTGA ATACTTCTCT TTGTTAATAT AATTTAATTT
TGGGATTGCA TTCAGAGAGC CTTCTGATGC ACATAGAGTA TATGGGTTTG TTGTTTGTTA CTTAATAGTT TGCTCTGTGG
CAGGCGGCTG TTGAGGAAGG TATTGTTGTT GGAGGTGGCT GTACGCTTTT GCGGCTTGCA TCAAAAGTTG ATGCCATTAT
AGAAACACTT GAGAATGATG AACAGAAGGT AGGAAAACAA ATGAAATAAT CTTTGGTTAT TGTTTCATTT CATCCTAGGT
TCAAGGCATT TGTTTTCTAT TGTCAATAAT TAAAATTTCT TTTTGGCTTC AAGGTTGGGG CTGAAATCGT AAGGAAGTCC
TTGAGTTACC CACTTAAATT AATAGCAAAA AATGCTGGTG TTAACGGCAG TGTTGTTACT GAGAAGGTTT GTACTCTGAC
ATTTGTTCTT AAGTACGATG AATATGCAAT TCTGCAGCTC GTGTGTAACG AATTTTTGAA CATGTATGAT TTCAGGTCCT
TGCCAATGAT AACTTCAGGT ATGGTTACAA TGCCGCTACA GGAAAATATG AGGATTTGAT GGCTGCTGGT ATTATTGATC
CCACCAAGGT AATTTTCTGC CGAATCAATG CGCTTTCTTA TTCGTAGTCA CATCAGAAGT AATTCTTTCA TTATTAGAAT
ATATATTGAA ATGCACGTGT GCCTTTGTGT TGTGCTGTAA AATTAATATA ACCGATTTAC CATGTTGAAC CGATAGAAGT
GATCAGCTGC ATGAAGATGA ACCTCTGGGA TATGGATTTT CTTTCCTTGC AATCAAACAA GGATGTTTTC CACCCTATTT
TTTATATTAG TATTTTGAGT CCATAAAGCT AACGTTGTGT GAAACAGGTG GTGAGATGTT GCTTGGAGCA TGCTGCGTCG
GTGGCGAAAA CATTCATCAC ATCAGATGCT GTTGTGGTGG ACATCAAGGA GCCTGAGAAA GCAGCTGCTG CTGGGAACCC
AATGGGTGGA TCAGGTACAC GGACCTGCTC ATCATGATCA AACAGTAGTA TATATTGTAT GCTTGAACAG AGTTTGCTAA
TTGTTTTTTG TTCAGGTTTT GGATTTTAGT TTAGAAGAAG AGGAGTACCC TTTTTGGCAG TTGGCAACCA TTTTTACACT
GGAGGCAGGC AGAATTTCAC AGTTGCATCT GAGACGTTTT TTCTTTTCCT GTGTGTAATT GTTGCGTACG TCAATGTGGC
AGATGAGAGG AGTAGTAGGT TATGAATGGC CAGCATTATG ACAGTTTATT GTTGCTCGAC CTTACAGAAG AGCTGAAACA
GTGCAACATA ATGTTTTTAA GGTTGAGAAT TATGCAAGCT GAAGTAGTTG GTAATAACCG GGAGAGGATT GTGTTGTCGT
TGGAGTAGAT GATGATTTTA CTAGCTAGTT AGATCGAGTT ACAAACATAT AATTAATTAA TTAAGGGGGC ATTGGCAGAT
TACAATAATA AATAAATTAT TTACATG

Locus: Os02g0102900

Loading...

Locus: Os02g0102900

Loading...