Os02t0106100-01

Locus

Os02g0106100

Description

Vacuolar acid invertase, Sugar metabolism, Regulation of grain size

RAP-DB Gene Symbol Synonym(s)

OsVIN2, SGS1

RAP-DB Gene Name Synonym(s)

vacuolar invertase 2, small grain size1

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OSINV3, OsINV3, INV3, OsVIN2, VIN2, VINV

Oryzabase Gene Name Synonym(s)

invertase 3, fructosyl transferase, vacuolar invertase 2

Transcript Evidence

AK072245

Protein Evidence

Q6ETD3

Literature

PMID: 31321495

Note

Manual Curation

July 22, 2019

Gene Ontology (GO)

Biological Process: carbohydrate metabolic process (GO:0005975)

Molecular Function: hydrolase activity, hydrolyzing O-glycosyl compounds (GO:0004553)

Molecular Function: beta-fructofuranosidase activity (GO:0004564)

Molecular Function: sucrose alpha-glucosidase activity (GO:0004575)

Functional domain (InterPro)

Glycosyl hydrolase, five-bladed beta-propellor domain superfamily (IPR023296)

Concanavalin A-like lectin/glucanase domain superfamily (IPR013320)

Glycoside hydrolase, family 32 (IPR001362)

Beta-fructofuranosidase (IPR021792)

Glycosyl hydrolase family 32, N-terminal (IPR013148)

Glycosyl hydrolase family 32, C-terminal (IPR013189)

Glycoside hydrolase, family 32, active site (IPR018053)

Full-length cDNA

J023002K22 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0106100-01)

RiceXPro (AK072245)

Others

Oryzabase (11688)

KEGG (Os02t0106100-01 (EC:3.2.1.26))

Transcript

2442 bp

>Os02t0106100-01 Vacuolar acid invertase, Sugar metabolism, Regulation of grain size
GCACACAACGCAAACGCAAACTAATCTCCTCTTCTCCTCTCCTCCCTTTTTCTTTCTTGT
GCTAATATTATATCCATCTCGCGGCGACGCGACGATCATGGAGACCCGGGACGACGTCGC
CGACGCCTCGGCGCTTCCCTACTCCTACTCGCCGCTCCCCGCCGGGGACGCCGCCTCCGC
CGACCTCGCCGCCGCCCGCCGTTCCCGGAGGCGCCCGCTCTGCGTCGCCCTGTTCCTCGC
CTCCGCCGCGGTGATCCTCGCCGTGGCGGTCCTCTCCGGCGTCAGGCTCGCCGGGCGCCC
CGCGACGACGACGATGGTCGTCCCGGGGGTGGTGGAGATGGAGATGGCGAGCAGGGGGCC
GGAGTCCGGCGTGTCGGAGAAGACGTCGGGGGCGGAGGAGATGGTGAGGCTGATGGGCGG
CGCGGCGGGTGGGGAGGCGTTCCCGTGGAGCAACGCGATGCTGCAATGGCAGCGCACCGG
ATTCCATTTCCAGCCCGAGAGGAACTGGATGAACGATCCCAACGGTCCGGTGTACTACAA
GGGTTGGTACCACCTGTTCTACCAGTACAACCCGGATGGGGCGGTGTGGGGCAACAAGAT
CGCGTGGGGGCACGCGGTGTCCCGCGACCTCGTCCACTGGCGCCACCTCCCCCTCGCCAT
GGTTCCCGACCAGTGGTACGACGTCAACGGCGTCTGGACCGGCTCCGCcaccaccctccc
cgacggccgcctcgccatgctctacaccggctccaccaacgcctccgtccaggtccagtg
cctcgccgtcccctccgaccccgacgaccccctcctcaccaactggaccaagtaccacgc
caaccccgtcctctaccctccccgcaccatcggcgaccgcgacttccgcgaccccaccac
cgcctggcgcgacccctccgacggcgactggcggatcgtcatcggctccaaggacgagca
ccacgccggcatcgccgtcgtctaccgcaccgccgacttcgtcacctacgacctcctccc
gggcctcctccaccgcgtcgaggccacgGGGATGTGGGAGTGCATCGACTTCTACCCGGT
GGCCGGCGGCGAGGGGGTGGACATGACGGAGGCGATGTACGCGAGGAACAAGGGGGTGGT
GCACGTGATGAAGGCGAGCATGGACGACGATCGCCATGACTACTACGCGCTGGGGAGGTA
CGACCCGGCGAGGAACGCGTGGACGCCGCTGGACGCCGCCGCCGACGTCGGCATCGGCCT
CCGCTACGACTGGGGCAAGTTCTATGCCTCCAAGACCTTCTACGATCCGGCCAAGCGCCG
CCGCGTCCTCTGGGGTTGGGTCGGCGAGACCGACTCCGAGCGCGCCGACGTCGCCAAGGG
TTGGGCTTCCCTCCAGTCGATTCCTCGGACGGTGGAGCTGGACACCAAGACGGGGAGCAA
CCTGCTGCAATGGCCGGTGGAGGAGGTGGAGACGCTGCGCACCAACTCCACCGACTTCGG
CGGCATCACCGTCGACTACGCCTCCGTCTTCCCGCTCAACCTCCACCGCGCCACGCAGCT
CGACATCCTCGCCGAGTTCCAGCTCGACCCGCTCGCCGTCGACGCCGTCCTCGAGGCCGA
CGTCGGCTACAACTGCAGCACCAGCGGCGGCGCGGCCGGCCGGGGCGCCCTGGGCCCCTT
CGGGCTGCTGGTGCTCGCCGACAAGCGCCACCGCGGGGATGGGGAGCAGACCGCCGTGTA
CTTCTACGTGGCCAAGGGGAGCGACGGCGGCGTCACGACGCACTTCTGCCAGGACGAGTC
GAGGTCGTCGCACGCCGACGACATCGTCAAGAGGGTCGTCGGCAACGTCGTCCCGGTGCT
CGACGGCGAGACCTTCTCCCTCCGGGTGCTCGTCGACCACTCCATCGTCGAGAGCTTCGC
GCAGGGGGGGAGGTCCACGGCGACGTCGCGGGTGTACCCCACGGAGGCCATCTACGCCAA
CGCCGGCGTCTTCCTCTTCAACAACGCCACCAGCGCGCGCGTCACGGCCAAGAAGCTCGT
CGTCCACGAGATGGACTCCTCCTACAACCAAGCCTACATGGCCTAGACTCCTCTCTTCTT
CTTCTTCTTCTTCTTCTCCATTATTACATTATTGCTGCTTACTTGTAAATCATTTTTGAC
GCCGCCGCCTGCTGCTAGCTGCTGGCCTGGCCTTCAGAATTTTATCTCTTTGCTTCTTTT
TTTTTTTGTCTCTGCTTTAATTTTGTATCTCGATCGATCTCGACCGATCGATTAATTACT
ATATCTCCATGAAGAAATGCATGGATGATGGATCATGGATGGATCGCTCCCTTCGATCCA
ACTGTACCTAGGGGAAGAAGATGCCATGGTCAAGCAATACTTCTGTAAATGTTTCACATG
AGTCAAGATTTATGCAGAGTTATAATATATATGTTTCTCTCT

CDS

1989 bp

>Os02t0106100-01 Vacuolar acid invertase, Sugar metabolism, Regulation of grain size
ATGGAGACCCGGGACGACGTCGCCGACGCCTCGGCGCTTCCCTACTCCTACTCGCCGCTC
CCCGCCGGGGACGCCGCCTCCGCCGACCTCGCCGCCGCCCGCCGTTCCCGGAGGCGCCCG
CTCTGCGTCGCCCTGTTCCTCGCCTCCGCCGCGGTGATCCTCGCCGTGGCGGTCCTCTCC
GGCGTCAGGCTCGCCGGGCGCCCCGCGACGACGACGATGGTCGTCCCGGGGGTGGTGGAG
ATGGAGATGGCGAGCAGGGGGCCGGAGTCCGGCGTGTCGGAGAAGACGTCGGGGGCGGAG
GAGATGGTGAGGCTGATGGGCGGCGCGGCGGGTGGGGAGGCGTTCCCGTGGAGCAACGCG
ATGCTGCAATGGCAGCGCACCGGATTCCATTTCCAGCCCGAGAGGAACTGGATGAACGAT
CCCAACGGTCCGGTGTACTACAAGGGTTGGTACCACCTGTTCTACCAGTACAACCCGGAT
GGGGCGGTGTGGGGCAACAAGATCGCGTGGGGGCACGCGGTGTCCCGCGACCTCGTCCAC
TGGCGCCACCTCCCCCTCGCCATGGTTCCCGACCAGTGGTACGACGTCAACGGCGTCTGG
ACCGGCTCCGCcaccaccctccccgacggccgcctcgccatgctctacaccggctccacc
aacgcctccgtccaggtccagtgcctcgccgtcccctccgaccccgacgaccccctcctc
accaactggaccaagtaccacgccaaccccgtcctctaccctccccgcaccatcggcgac
cgcgacttccgcgaccccaccaccgcctggcgcgacccctccgacggcgactggcggatc
gtcatcggctccaaggacgagcaccacgccggcatcgccgtcgtctaccgcaccgccgac
ttcgtcacctacgacctcctcccgggcctcctccaccgcgtcgaggccacgGGGATGTGG
GAGTGCATCGACTTCTACCCGGTGGCCGGCGGCGAGGGGGTGGACATGACGGAGGCGATG
TACGCGAGGAACAAGGGGGTGGTGCACGTGATGAAGGCGAGCATGGACGACGATCGCCAT
GACTACTACGCGCTGGGGAGGTACGACCCGGCGAGGAACGCGTGGACGCCGCTGGACGCC
GCCGCCGACGTCGGCATCGGCCTCCGCTACGACTGGGGCAAGTTCTATGCCTCCAAGACC
TTCTACGATCCGGCCAAGCGCCGCCGCGTCCTCTGGGGTTGGGTCGGCGAGACCGACTCC
GAGCGCGCCGACGTCGCCAAGGGTTGGGCTTCCCTCCAGTCGATTCCTCGGACGGTGGAG
CTGGACACCAAGACGGGGAGCAACCTGCTGCAATGGCCGGTGGAGGAGGTGGAGACGCTG
CGCACCAACTCCACCGACTTCGGCGGCATCACCGTCGACTACGCCTCCGTCTTCCCGCTC
AACCTCCACCGCGCCACGCAGCTCGACATCCTCGCCGAGTTCCAGCTCGACCCGCTCGCC
GTCGACGCCGTCCTCGAGGCCGACGTCGGCTACAACTGCAGCACCAGCGGCGGCGCGGCC
GGCCGGGGCGCCCTGGGCCCCTTCGGGCTGCTGGTGCTCGCCGACAAGCGCCACCGCGGG
GATGGGGAGCAGACCGCCGTGTACTTCTACGTGGCCAAGGGGAGCGACGGCGGCGTCACG
ACGCACTTCTGCCAGGACGAGTCGAGGTCGTCGCACGCCGACGACATCGTCAAGAGGGTC
GTCGGCAACGTCGTCCCGGTGCTCGACGGCGAGACCTTCTCCCTCCGGGTGCTCGTCGAC
CACTCCATCGTCGAGAGCTTCGCGCAGGGGGGGAGGTCCACGGCGACGTCGCGGGTGTAC
CCCACGGAGGCCATCTACGCCAACGCCGGCGTCTTCCTCTTCAACAACGCCACCAGCGCG
CGCGTCACGGCCAAGAAGCTCGTCGTCCACGAGATGGACTCCTCCTACAACCAAGCCTAC
ATGGCCTAG

Protein

663 aa

>Os02t0106100-01 Vacuolar acid invertase, Sugar metabolism, Regulation of grain size
METRDDVADASALPYSYSPLPAGDAASADLAAARRSRRRPLCVALFLASAAVILAVAVLS
GVRLAGRPATTTMVVPGVVEMEMASRGPESGVSEKTSGAEEMVRLMGGAAGGEAFPWSNA
MLQWQRTGFHFQPERNWMNDPNGPVYYKGWYHLFYQYNPDGAVWGNKIAWGHAVSRDLVH
WRHLPLAMVPDQWYDVNGVWTGSATTLPDGRLAMLYTGSTNASVQVQCLAVPSDPDDPLL
TNWTKYHANPVLYPPRTIGDRDFRDPTTAWRDPSDGDWRIVIGSKDEHHAGIAVVYRTAD
FVTYDLLPGLLHRVEATGMWECIDFYPVAGGEGVDMTEAMYARNKGVVHVMKASMDDDRH
DYYALGRYDPARNAWTPLDAAADVGIGLRYDWGKFYASKTFYDPAKRRRVLWGWVGETDS
ERADVAKGWASLQSIPRTVELDTKTGSNLLQWPVEEVETLRTNSTDFGGITVDYASVFPL
NLHRATQLDILAEFQLDPLAVDAVLEADVGYNCSTSGGAAGRGALGPFGLLVLADKRHRG
DGEQTAVYFYVAKGSDGGVTTHFCQDESRSSHADDIVKRVVGNVVPVLDGETFSLRVLVD
HSIVESFAQGGRSTATSRVYPTEAIYANAGVFLFNNATSARVTAKKLVVHEMDSSYNQAY
MA*

5'UTR

chr02:343057..343153 (+ strand) : 97 bp

CDS

chr02:343154..343580 (+ strand) : 427 bp

chr02:343956..344827 (+ strand) : 872 bp

chr02:345830..346519 (+ strand) : 690 bp

3'UTR

chr02:346520..346875 (+ strand) : 356 bp

FASTA

>Os02t0106100-01 class=Sequence position=chr02:343057..346875 (+ strand)
GCACACAACG CAAACGCAAA CTAATCTCCT CTTCTCCTCT CCTCCCTTTT TCTTTCTTGT GCTAATATTA TATCCATCTC
GCGGCGACGC GACGATCATG GAGACCCGGG ACGACGTCGC CGACGCCTCG GCGCTTCCCT ACTCCTACTC GCCGCTCCCC
GCCGGGGACG CCGCCTCCGC CGACCTCGCC GCCGCCCGCC GTTCCCGGAG GCGCCCGCTC TGCGTCGCCC TGTTCCTCGC
CTCCGCCGCG GTGATCCTCG CCGTGGCGGT CCTCTCCGGC GTCAGGCTCG CCGGGCGCCC CGCGACGACG ACGATGGTCG
TCCCGGGGGT GGTGGAGATG GAGATGGCGA GCAGGGGGCC GGAGTCCGGC GTGTCGGAGA AGACGTCGGG GGCGGAGGAG
ATGGTGAGGC TGATGGGCGG CGCGGCGGGT GGGGAGGCGT TCCCGTGGAG CAACGCGATG CTGCAATGGC AGCGCACCGG
ATTCCATTTC CAGCCCGAGA GGAACTGGAT GAACGATCCC AACGGTACTT AATTTCTTTG CATTTTTTTT CTTTTATTTT
CCTTCTTCGA TCGATCGATT GATTGTTCTC ATCTCAATTC GTTCATTCCT TCCGCTCTGT TCGTTCGTTC TTCTAGATCT
GACAACATTC AAATGCTATT AAATAAATTC CCATTTTGGA GGAACGTTTT ATGGTTAAGA TTCTTCCAGC CCCATTTTCC
TTTTTTTTTA TTTATTTTTG AGAAAAGATT TAAAAATAAA AAAGGAAAAC CGAGATACCC TTAAGATTCC AACCGCACCA
ACCGACCAGG CATTGTAGAA TTCGAATTAC AATAATTTTT AGATAGATAA AATTCAAATT ACATTATATA ATCAAATTAA
CATTGGAAAT GCAATGCAGG TCCGGTGTAC TACAAGGGTT GGTACCACCT GTTCTACCAG TACAACCCGG ATGGGGCGGT
GTGGGGCAAC AAGATCGCGT GGGGGCACGC GGTGTCCCGC GACCTCGTCC ACTGGCGCCA CCTCCCCCTC GCCATGGTTC
CCGACCAGTG GTACGACGTC AACGGCGTCT GGACCGGCTC CGCcaccacc ctccccgacg gccgcctcgc catgctctac
accggctcca ccaacgcctc cgtccaggtc cagtgcctcg ccgtcccctc cgaccccgac gaccccctcc tcaccaactg
gaccaagtac cacgccaacc ccgtcctcta ccctccccgc accatcggcg accgcgactt ccgcgacccc accaccgcct
ggcgcgaccc ctccgacggc gactggcgga tcgtcatcgg ctccaaggac gagcaccacg ccggcatcgc cgtcgtctac
cgcaccgccg acttcgtcac ctacgacctc ctcccgggcc tcctccaccg cgtcgaggcc acgGGGATGT GGGAGTGCAT
CGACTTCTAC CCGGTGGCCG GCGGCGAGGG GGTGGACATG ACGGAGGCGA TGTACGCGAG GAACAAGGGG GTGGTGCACG
TGATGAAGGC GAGCATGGAC GACGATCGCC ATGACTACTA CGCGCTGGGG AGGTACGACC CGGCGAGGAA CGCGTGGACG
CCGCTGGACG CCGCCGCCGA CGTCGGCATC GGCCTCCGCT ACGACTGGGG CAAGTTCTAT GCCTCCAAGA CCTTCTACGA
TCCGGCCAAG CGCCGCCGCG TCCTCTGGGG TTGGGTCGGC GAGACCGACT CCGAGCGCGC CGACGTCGCC AAGGGTTGGG
CTTCCCTCCA GGTACACCTT CATTACCTCT CTaaactatt ttaagtttaa ctaagttcat ggacaaacat atattaaatt
agtttcatca aatcaataat taaatatatt tttataatat atttgttttg ggtgaaaatt ttactacttt tttctataaa
cttagttaaa tttaaagcag gaatttgact aaaATTAAAA ACAACTTATA ACTCGAAACG GAGGGAGGGA GTATATATTA
ATTAATCCAG CTACTACTAG TAATTAGCTA GCATGCATGA TTAGCTAGGC ATCATTGGCA TGCATATGTG CACTTTTACT
GGGCTCCATT GACACGTTGG ATCGACGAAC AACACGTACA TATGCATATG CCTGCCGGAG TGTAGCGTAG CAATCAAATA
ATGGCAGCCA CTTGTGAAGA GCGAGAGAGA TGACGCGAAC AAACAAAAAG CTTGTCATGT TGGTTGTCAA AATGTCGCTT
AGCTTCATCC AGGAATGAAT GCGGATATCC TGTTGGGGCC CCACTGCTCA GCTACCGACC GGAGCAACTG TTGAGATACC
CTTTTTTGCA ATAATTGACA TAATAAACAG ATCGTATTAT TATTGGTTGA TGGATGGAAT TGCTTGTGTC CAAGCTATAG
TCCTCCTAGC AACTGTTACT ACTAGTAGGA ATAGCTGTCC TTGCCCATAA CTCATGTGCA ACCATGTGCT GTAGCTGCAT
TCTGCTTGTC TTTGCTGATG CTTTGCCTAA CTGAAATCAT TTGCACACAC AACTTAACTG GGATTCATAG ATTGCAACCT
TTTCTTTTCA CCAGAAAAAG GGCTGTCTTT TTTGCTTGCT TTTCAATATA ATTCCACCGC TCTCATTTTC TTTGCTGTCA
CAGTACTGAT AGATAATGCA AAATCGCTTG GTTCATGTGA AGCAAGCTAT AGTAATAATA ATTATGATTA ACATGTGTAA
TTAAATTACT GGAGTAGTAG CTAATTAGTA AAAATAAAAA AATTGGCATG CAGTCGATTC CTCGGACGGT GGAGCTGGAC
ACCAAGACGG GGAGCAACCT GCTGCAATGG CCGGTGGAGG AGGTGGAGAC GCTGCGCACC AACTCCACCG ACTTCGGCGG
CATCACCGTC GACTACGCCT CCGTCTTCCC GCTCAACCTC CACCGCGCCA CGCAGCTCGA CATCCTCGCC GAGTTCCAGC
TCGACCCGCT CGCCGTCGAC GCCGTCCTCG AGGCCGACGT CGGCTACAAC TGCAGCACCA GCGGCGGCGC GGCCGGCCGG
GGCGCCCTGG GCCCCTTCGG GCTGCTGGTG CTCGCCGACA AGCGCCACCG CGGGGATGGG GAGCAGACCG CCGTGTACTT
CTACGTGGCC AAGGGGAGCG ACGGCGGCGT CACGACGCAC TTCTGCCAGG ACGAGTCGAG GTCGTCGCAC GCCGACGACA
TCGTCAAGAG GGTCGTCGGC AACGTCGTCC CGGTGCTCGA CGGCGAGACC TTCTCCCTCC GGGTGCTCGT CGACCACTCC
ATCGTCGAGA GCTTCGCGCA GGGGGGGAGG TCCACGGCGA CGTCGCGGGT GTACCCCACG GAGGCCATCT ACGCCAACGC
CGGCGTCTTC CTCTTCAACA ACGCCACCAG CGCGCGCGTC ACGGCCAAGA AGCTCGTCGT CCACGAGATG GACTCCTCCT
ACAACCAAGC CTACATGGCC TAGACTCCTC TCTTCTTCTT CTTCTTCTTC TTCTCCATTA TTACATTATT GCTGCTTACT
TGTAAATCAT TTTTGACGCC GCCGCCTGCT GCTAGCTGCT GGCCTGGCCT TCAGAATTTT ATCTCTTTGC TTCTTTTTTT
TTTTGTCTCT GCTTTAATTT TGTATCTCGA TCGATCTCGA CCGATCGATT AATTACTATA TCTCCATGAA GAAATGCATG
GATGATGGAT CATGGATGGA TCGCTCCCTT CGATCCAACT GTACCTAGGG GAAGAAGATG CCATGGTCAA GCAATACTTC
TGTAAATGTT TCACATGAGT CAAGATTTAT GCAGAGTTAT AATATATATG TTTCTCTCT