Os02t0111200-00

Locus

Os02g0111200

Description

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CYP17

CGSNL Gene Name

CYCLOPHILIN 17

Oryzabase Gene Symbol Synonym(s)

OsCYP17, OsCYP-4

Oryzabase Gene Name Synonym(s)

cyclophilin 17, cyclophilin 4

Transcript Evidence

Protein Evidence

Literature

Note

Manual Curation

Expression Databases

TENOR (Os02t0111200-00)

Others

Oryzabase (10053)

Transcript

420 bp

>Os02t0111200-00
ATGGAGCTGTACGCGGACCTGGTCCCCCTCACCGCGGAGAACTTCCGCGCCCTCTACACC
AAGAAGCCGCTCCACTACAAAGGGCTTTGTCTTTCACAGCATTATCCCAGGATACATGTG
GAAGGGCGGCGACTTCGTCAAGGACCATGGCACCGGCGGCGAGTTCATTTGCGGCGACAC
CTTCCCAATGAGAATTTCCTACTTCCACACGACCGCCCGTGGTTACCCAACGGCTCCGCC
GAAAACAACATCTCACAGTTCTTTACCCGCGTGCCCTGGTTCGATGGCAACTACGTCGTC
TTCGGCTGTATCATCTCCGGCTTCCACAACCTCAAGGCCATCGAAGCGGAGGTGGAGGTC
AAGATTGCCAACCGTGGCGAGGTCGTCATTGTCCCGCCGCCGTCGTTAACTACTAATTAA

CDS

420 bp

>Os02t0111200-00
ATGGAGCTGTACGCGGACCTGGTCCCCCTCACCGCGGAGAACTTCCGCGCCCTCTACACC
AAGAAGCCGCTCCACTACAAAGGGCTTTGTCTTTCACAGCATTATCCCAGGATACATGTG
GAAGGGCGGCGACTTCGTCAAGGACCATGGCACCGGCGGCGAGTTCATTTGCGGCGACAC
CTTCCCAATGAGAATTTCCTACTTCCACACGACCGCCCGTGGTTACCCAACGGCTCCGCC
GAAAACAACATCTCACAGTTCTTTACCCGCGTGCCCTGGTTCGATGGCAACTACGTCGTC
TTCGGCTGTATCATCTCCGGCTTCCACAACCTCAAGGCCATCGAAGCGGAGGTGGAGGTC
AAGATTGCCAACCGTGGCGAGGTCGTCATTGTCCCGCCGCCGTCGTTAACTACTAATTAA

Protein

140 aa

>Os02t0111200-00
MELYADLVPLTAENFRALYTKKPLHYKGLCLSQHYPRIHVEGRRLRQGPWHRRRVHLRRH
LPNENFLLPHDRPWLPNGSAENNISQFFTRVPWFDGNYVVFGCIISGFHNLKAIEAEVEV
KIANRGEVVIVPPPSLTTN*

CDS

chr02:613113..613532 (+ strand) : 420 bp

FASTA

>Os02t0111200-00 class=Sequence position=chr02:613113..613532 (+ strand)
ATGGAGCTGT ACGCGGACCT GGTCCCCCTC ACCGCGGAGA ACTTCCGCGC CCTCTACACC AAGAAGCCGC TCCACTACAA
AGGGCTTTGT CTTTCACAGC ATTATCCCAG GATACATGTG GAAGGGCGGC GACTTCGTCA AGGACCATGG CACCGGCGGC
GAGTTCATTT GCGGCGACAC CTTCCCAATG AGAATTTCCT ACTTCCACAC GACCGCCCGT GGTTACCCAA CGGCTCCGCC
GAAAACAACA TCTCACAGTT CTTTACCCGC GTGCCCTGGT TCGATGGCAA CTACGTCGTC TTCGGCTGTA TCATCTCCGG
CTTCCACAAC CTCAAGGCCA TCGAAGCGGA GGTGGAGGTC AAGATTGCCA ACCGTGGCGA GGTCGTCATT GTCCCGCCGC
CGTCGTTAAC TACTAATTAA 

Locus: Os02g0111200

Loading...

Locus: Os02g0111200

Loading...