Os02t0111500-01

Locus

Os02g0111500

Description

Hypothetical gene.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK119503 (DDBJ, Best hit)

Protein Evidence

longestORF

Literature

Note

Manual Curation

Full-length cDNA

001-134-E11 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0111500-01)

RiceXPro (AK119503)

Others

KEGG (Os02t0111500-01)

Transcript

1403 bp

>Os02t0111500-01 Hypothetical gene.
ATTTATCTTCTTTCAGTCACATTGTATTATTTGAGTCTGAAGAAAGGCATCTCAAGTTGC
TTCTGCACAATTCTTTTAGAGAGGGCTCTCTCTTTGGATCTGTACTTTGAGTCCCAGGCC
CGCAGTAGCAATGGTAGCCCCCAATTGTGTTGTCGCAGATTCCATGGCAGTACTGACCCG
GAGATTCGCACTCGTTGATATCTGTTGACGCCATGGAAAAGTAGCAAAACAACTGAAGAT
CAATGCACAGATGGACATAAGGTGAACTTGAAAAATAGAAGTGAATTGCAGTGAGTTGGT
TACCTTGGCACCCTCCTTCCAGGTACGGGTTGCCTGCAAACCCATTGTTGCAGGCACAGA
GATACCCGGTAGCATTTGGTGAGTTGATGCAGCTGCTGTTCGTGCTAACACAGGCATATG
ATGTCCTGTTCTTGGGCGCTTGGGCACATGATTCTCTTCCAGCAACCCAATCAAGCACAG
TGGGAACCCCTTTGTACTTGTCTGTGAACTTGTGACCTTCTAGGTAATCAGGCTCAAACC
TGAACCAGTCTTGCTCGGCAACGAAGGCATAACTGCATGGGTTGAAGCTGTTCACCTCAG
AATTGTTGAACCTGCTGTCGAATGTCACGTTTAAGGAGGTGAGATTTGGTGCAATAGATG
TCTGGCAACAGCCCATGCCGGAGCACTGGCCGCTACTGTCCACACTCTGCTTGTCGGGGC
ACATCGAGAAGCACCCAGCCCCAACGTTCTGTTCTTCCTCGTTGTAGCCCCCCAGGAATG
CAAGGGTATTGCATCCAACCACCGTTAACTTGTTAGCCCTGCTGGATAATGTGAAAAAAG
GAGCAGTAGATGTTGATACCCAACCATCTGTTGAAGTGCCATCTGTGTTGTTGGAGCACT
TGTCGGCGATGAAGGTGCTGACTTGAGCCTGCCCTCCAATCAGATTGAGGCTGTAGATCT
CCATGTTGCTGCTTGAGTTATGCATGTAGGTGCGGTTCTCCTCGCATGAAACGTCGAACC
CATCAGTGTAGAAGCAACCAGCACCGATGCCGAAGGGGTAGGGAATGGTGAGGTTGCCGC
ATGTTCCTCTGCATCTAGGCTTAGCCATCCTGGATGCTGCACTGAAGCTGATGGTTGCTA
GCAGTAGGGTGGTTGCAAGGATCATCCATGGTACTACTCCAGTCATCTCTCTGTATGTCT
TGTATTATGATTCTCCTATAGGTTCTAGTTCTCTTCTAACTGAGCTATGCTTATATAATG
AAGCAAGCCTCTGGAGGTCCAGTCCTTagaccctatttagatgggactaaaagttttaaa
tccctatcacatcagatgtttagacactaattataaatattaaacgtaggctattaataa
aaatccatccataatcttggact

CDS

225 bp

>Os02t0111500-01 Hypothetical gene.
ATGGTGAGGTTGCCGCATGTTCCTCTGCATCTAGGCTTAGCCATCCTGGATGCTGCACTG
AAGCTGATGGTTGCTAGCAGTAGGGTGGTTGCAAGGATCATCCATGGTACTACTCCAGTC
ATCTCTCTGTATGTCTTGTATTATGATTCTCCTATAGGTTCTAGTTCTCTTCTAACTGAG
CTATGCTTATATAATGAAGCAAGCCTCTGGAGGTCCAGTCCTTag

Protein

74 aa

>Os02t0111500-01 Hypothetical gene.
MVRLPHVPLHLGLAILDAALKLMVASSRVVARIIHGTTPVISLYVLYYDSPIGSSSLLTE
LCLYNEASLWRSSP*

5'UTR

chr02:626299..626381 (+ strand) : 83 bp

chr02:629392..630372 (+ strand) : 981 bp

CDS

chr02:630373..630597 (+ strand) : 225 bp

3'UTR

chr02:630598..630711 (+ strand) : 114 bp

FASTA

>Os02t0111500-01 class=Sequence position=chr02:626299..630711 (+ strand)
ATTTATCTTC TTTCAGTCAC ATTGTATTAT TTGAGTCTGA AGAAAGGCAT CTCAAGTTGC TTCTGCACAA TTCTTTTAGA
GAGGTAAAAC CATGTTGAAT CTTAAAATCT CTTCTTCCCT CAGTTTAATA GGCATATGCA TATACCTTTT TTCTGTTTGG
TAGTTTAGAT TTCCCTTTTG TAAGACCTTG TCAGTTTGTT TTAGGCTTTC TTTCGAAAGC CGGGTAATGA AGTTTACCTG
CAGTCTAAAA AAAATGCATA TACTTAGTAG TCTTTATTTA TATGATGTTT TAGAAACTTG TGCTTAAACT TTTCTTACTC
AATGCCTTGT AAATTGGTCA tgttgaaatt tttatcatta gatttgcaat ataattttgc actagcatat gcatataaat
tgATATTGAA GTCAGACATT GCAGCTGATG TCCAAATGGA ACTGATTACT TCTAAAAAGA AAAAAAAATC AAAGGTATTG
TTCAAGTTGG TTCATAAAGA AATGTCTAAA ACACAAAGGA TGGGCCACAT TTTTAAGTTT GTGCCCCCCC CCCTTCTCTC
TCTCGCGTGG ATGCACGCCT CCTCTCATGT TGTAGTATTG GCTATGCACG ATCAGATGAC TATGATAATG ACATATTTTG
CGGTAACATT GTGGGTGTAC CAACCCTAGT GTCCTAATAT CAAGAACTAC GTGTCCTAGA AACCAGTATA ATTAAATTCC
CTTTTGTGAG TAGTCCTCCT AGCAAGAATT GCCATCAGTT TGTAAGGTGA GCATCTGACA CAAGCTCTGC ATTGCTTGCA
ATCGATGGCA AAATAAAATC AGGTTATTGT TTGTTGCACT CAGGTAGTTA ATAGTTTTAT TGTAGTTACA ATTTGTGAAC
TAGCTGTCTT AAAACATGAT GGATAGGTTG CATTACATTG CATGATTGGC TGTGTATGAC GTGATAATTA ATATATTATC
TCTTGTATTC TTAATCTTTC CTGTCCATTA ACATCATGAC ATGTGTCCTG GTTGGCAGGC TAGGAGATTT TTTCACTCCC
ACTTCAAGGT TGATAGAGAC CTTCAGTCAT CAGTTGTAGT TTATTCACGG ATGAATGTAT TGTGATTGCT GTGGCAGAAA
AGGCCTGTTA CTTCGTTAGT CTACTATCTT GTCTAACAAT TTCTAATCAT GTTTTGGCCT TCTTTAATTT GTCATTCAAT
AAATGATCTG TAACTTGGGC CTTTATTTTG AGAGAGAGAA TTTTTCCCAT CCTTTATGAT GCGATTCTAT GTCGATGTAT
TGGCGGCAAC TTCCATGGTG AAAGTAGGAC AAACCACCTG GTAAAAAACA AAGAAGGTAG GACAGACCAT TCCATGGCAC
ATTGTTGTTG CTGACATACT GAACCTCATA AAATCATGTC ACATATAAGT TTTCATTGAT TTCCTGCAGT TTTTATTCTT
GAACACAAAT ATTTTTACAA GATATTTATG TCAGGAGATG CTAATCGAAA CTCTGCTAAA ACCATTTATT GATACTTGCA
TACTCATCAT CTACCAGTTT CTATATCTAG CGCCATCAAG CTTCCGTGTC GTCCAGTGGT AGAAGGGTCA TACTGTGATG
AATTTTCAAG CAAACATACA GTTTCTTCAT TAGCACCCTC AATCAATTGC TCACGCCAGG TGCTTCTTAT TGCTTTTAAC
CTTTCAGCTA CTTCTGTCAT TAATGGCCGT TCTTCCCCCT TTGTACTCAA GCAGCATTTT GCCAGTTGAG CAACATCTTG
GAACAGCTCT GTTCCAACAC CTAATATGTT CCTGTCCAAG ATGGACTCAA GTCTGTTCTC TTTCAGTGCC AGAAGGAAGG
ATGATGCAAG GCTTTTCTTT TCTTCAGTAT TTTCAGAATA AATTGCAGtc tttcctgtta ttagttctag aagcacaact
ccaaagctat aaacatcact tttctgtgtt agctggcgct cttgtaagta ttctgggtct aggtagccta gagtcccctg
taccattgtc ataaactgta tttcatcttt tggaagcatc cttgatgctc caaagtcagt cacttttgtt atgtagttgt
cacctaggag aatgttggga gatttgacat caccatgaac tattGGAGGG GATGCTGATG AATGTAGATA TGCTAGTGCT
TCTGCAGATT CCTGAGCAAT CCGTAGACGA GCATCCAGTG AAATGGAGGT TGTTCTGTAT TTACCATGTA TATGCTCGAA
CAAAGTGCCA TTTGGGATGA ATTCATAGAC CAGCATTGGA ACTTCCACTT CTAAGCAACA ACCTAGAAGC CTTACCACAT
TCCTGTGGTT GATCTGTGAA AGTATAATCA TCTCTTGCAC AAATTCATCT TTCTGAACCA TATTCATAAT CTTTGAGCGC
TTTATGGCTA CTATTCTGTT GTCTTTGAGG ATCCCCTTGT ATACAGTGCC ATGACCGCCT CTTCCTAGTT CTTTGCTTGA
GTCAAAATTG TCTGTTGCAT TCTCTAGTTC TTCTTTTGTG AATATTCTCA CAGTATCAAC TTGCTTTGAC CGGATTTGCT
CATACAGCAG CATACCCCCA TTTTGTTGAA AGAACCTTTC TTTTTCTTTC ATCAGCTTTC TTTTCTGGCA TTCGATCAGT
AGTGCAAAAG TGCAACTAAG CAGTATAATA GCGCATACCG AAATGCCTGT GAAGAAAAAC CTTTTTTTAG TTACCAGAAG
TCGAGGAGAA ATTTTCTGTG GGTATTTATT GCTGAATTAG CATTATAATA CTGTATCCTT GTGTAAGATT GCTATATAAT
TGAACCTATG GCTGGAGATA ATTCTCCTAT AATATTTCTC AAGTTAGTTA CAGATAGTGA AACATTTTGC AATAGAATGC
TTACTGTAAT ATATGTATTT TGCCTATCTG TCTGGCTTCT AGCTAAGGGG AATGAAGTAG ACAATTCTAC CAAGCGGGAA
ATGTCAGGAG TCTACTGCAC AGTACCTTTT ATATGTTATT CCTTCATGAA ATATTAGGAC TTTGGAGTAT TGGGAATTAC
CTATAAACGT TTTTGTTAGT CTAGCTCTTT CTGAAGCTGT TATTGGATTG CAGGGCTCTC TCTTTGGATC TGTACTTTGA
GTCCCAGGCC CGCAGTAGCA ATGGTAGCCC CCAATTGTGT TGTCGCAGAT TCCATGGCAG TACTGACCCG GAGATTCGCA
CTCGTTGATA TCTGTTGACG CCATGGAAAA GTAGCAAAAC AACTGAAGAT CAATGCACAG ATGGACATAA GGTGAACTTG
AAAAATAGAA GTGAATTGCA GTGAGTTGGT TACCTTGGCA CCCTCCTTCC AGGTACGGGT TGCCTGCAAA CCCATTGTTG
CAGGCACAGA GATACCCGGT AGCATTTGGT GAGTTGATGC AGCTGCTGTT CGTGCTAACA CAGGCATATG ATGTCCTGTT
CTTGGGCGCT TGGGCACATG ATTCTCTTCC AGCAACCCAA TCAAGCACAG TGGGAACCCC TTTGTACTTG TCTGTGAACT
TGTGACCTTC TAGGTAATCA GGCTCAAACC TGAACCAGTC TTGCTCGGCA ACGAAGGCAT AACTGCATGG GTTGAAGCTG
TTCACCTCAG AATTGTTGAA CCTGCTGTCG AATGTCACGT TTAAGGAGGT GAGATTTGGT GCAATAGATG TCTGGCAACA
GCCCATGCCG GAGCACTGGC CGCTACTGTC CACACTCTGC TTGTCGGGGC ACATCGAGAA GCACCCAGCC CCAACGTTCT
GTTCTTCCTC GTTGTAGCCC CCCAGGAATG CAAGGGTATT GCATCCAACC ACCGTTAACT TGTTAGCCCT GCTGGATAAT
GTGAAAAAAG GAGCAGTAGA TGTTGATACC CAACCATCTG TTGAAGTGCC ATCTGTGTTG TTGGAGCACT TGTCGGCGAT
GAAGGTGCTG ACTTGAGCCT GCCCTCCAAT CAGATTGAGG CTGTAGATCT CCATGTTGCT GCTTGAGTTA TGCATGTAGG
TGCGGTTCTC CTCGCATGAA ACGTCGAACC CATCAGTGTA GAAGCAACCA GCACCGATGC CGAAGGGGTA GGGAATGGTG
AGGTTGCCGC ATGTTCCTCT GCATCTAGGC TTAGCCATCC TGGATGCTGC ACTGAAGCTG ATGGTTGCTA GCAGTAGGGT
GGTTGCAAGG ATCATCCATG GTACTACTCC AGTCATCTCT CTGTATGTCT TGTATTATGA TTCTCCTATA GGTTCTAGTT
CTCTTCTAAC TGAGCTATGC TTATATAATG AAGCAAGCCT CTGGAGGTCC AGTCCTTaga ccctatttag atgggactaa
aagttttaaa tccctatcac atcagatgtt tagacactaa ttataaatat taaacgtagg ctattaataa aaatccatcc
ataatcttgg act

Locus: Os02g0111500

Loading...

Locus: Os02g0111500

Loading...