Os02t0115900-01

Locus

Os02g0115900

Description

ER-localized chaperone HSP70, ER quality control for seed storage proteins during seed maturation, Regulation of XA21 protein stability and processing, Resistance to Xoo,

RAP-DB Gene Symbol Synonym(s)

BiP1, BiP3, OsBiP3

RAP-DB Gene Name Synonym(s)

Binding protein 1, endoplasmic reticulum (ER) chaperone BiP3

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsBiP1, BiP1, BiP, Bip3, OsBiP3, BIP1/OsBIP3, OsMed37_2, Med37_2

Oryzabase Gene Name Synonym(s)

ER chaperone BiP1, Binding protein 1, binding protein, endosperm lumenal binding protein, endoplasmic reticulum (ER) chaperone BiP3, Polypeptide chain-binding protein, Mediator 37_2

Transcript Evidence

AK119653

Protein Evidence

Q6Z7B0

Literature

PMID: 21223397

PMID: 20174657

PMID: 19567376

Note

Manual Curation

October 26, 2020

Functional domain (InterPro)

Heat shock protein 70kD, peptide-binding domain superfamily (IPR029047)

Heat shock protein 70kD, C-terminal domain superfamily (IPR029048)

Heat shock protein 70 family (IPR013126)

Endoplasmic reticulum chaperone BIP, nucleotide-binding domain (IPR042050)

Heat shock protein 70, conserved site (IPR018181)

Experimentally confirmed subcellular location

endoplasmic reticulum (GO:0005783)

Full-length cDNA

002-130-H01 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0115900-01)

RiceXPro (AK119653)

Others

Oryzabase (10082)

KEGG (Os02t0115900-01)

Transcript

2414 bp

>Os02t0115900-01 ER-localized chaperone HSP70, ER quality control for seed storage proteins during seed maturation, Regulation of XA21 protein stability and processing, Resistance to Xoo,
ATAAATCGCCCACGAACCCATAAAACTCAAACTCACTTGAAGGTTTTCGGATCGCAACCC
AAACTCGCACAAGGGAGAAGAGAAGAGAAGCTTCGAGAGAGAGGTGGAGGAGGAGACGAG
CGCGTGGTGGTGGTGGTGTTGGCGGCGATGGATCGGGTTCGCGGATGCGCGTTCCTGCTC
GGCGTCCTGCTCGCAGGATCCCTGTTTGCATTTTCTGTTGCGAAGGAGGAGACCAAGAAG
CTCGGTACCGTGATCGGTATTGATCTTGGTACAACCTACTCGTGTGTCGGTGTGTACAAG
AATGGTCATGTCGAGATTATCGCCAATGACCAGGGTAACCGTATCACACCCTCATGGGTT
GCATTCACCGATAGCGAGAGGCTCATCGGTGAGGCTGCCAAGAACCAGGCAGCTGTGAAC
CCAGAGAGGACCATCTTCGATGTCAAACGTCTCATTGGAAGAAAGTTTGAAGACAAGGAA
GTTCAGAGGGACATGAAACTTGTCCCCTACAAGATTGTGAACAAGGACGGTAAGCCCTAC
ATTCAGGTCAAGATCAAGGATGGAGAGAACAAGGTCTTCAGCCCTGAGGAGGTCAGTGCT
ATGATCCTTGGAAAGATGAAGGAGACTGCTGAGGCATACCTTGGCAAGAAGATCAACGAT
GCTGTCGTGACTGTTCCTGCGTACTTCAATGACGCGCAGAGGCAGGCAACCAAGGATGCC
GGTGTCATTGCTGGCCTGAATGTTGCTAGGATCATCAATGAGCCAACTGCTGCTGCTATT
GCGTACGGTTTGGACAAGAAGGGTGGTGAGAAGAACATCCTTGTCTTTGACCTTGGTGGT
GGGACATTCGATGTCAGTATCTTGACCATTGACAACGGTGTGTTTGAGGTGTTGGCCACC
AATGGTGACACTCATCTTGGAGGTGAGGACTTTGACCAGAGAATCATGGAGTACTTCATC
AAGTTGATCAAGAAGAAGTACAGCAAGGACATCAGCAAGGACAACCGTGCTCTTGGAAAG
CTGAGGAGGGAAGCTGAGCGTGCCAAGAGGGCCCTCAGCAACCAGCACCAGGTCCGTGTT
GAGATTGAGTCCCTCTTTGACGGGACCGATTTCTCGGAGCCGCTGACCCGTGCCAGATTT
GAGGAGTTGAACAATGATCTGTTCCGCAAGACCATGGGACCTGTCAAGAAGGCTATGGAC
GATGCTGGCCTTGAGAAGAGCCAGATTCATGAGATTGTTCTTGTCGGTGGTAGCACCAGG
ATTCCCAAGGTTCAGCAGCTCCTCAGAGACTACTTCGAGGGCAAGGAGCCCAACAAGGGT
GTCAACCCTGATGAGGCTGTTGCCTATGGTGCTGCGGTTCAGGGAAGCATTCTCAGCGGC
GAGGGCGGTGACGAAACCAAAGATATCCTTCTCCTGGATGTGGCACCCCTTACCCTCGGT
ATCGAGACTGTCGGTGGAGTCATGACCAAGTTGATCCCCAGGAACACCGTCATCCCCACC
AAGAAGTCCCAGGTGTTCACCACCTACCAGGATCAGCAGACAACCGTCTCCATCCAGGTC
TTTGAGGGTGAGCGCAGCATGACCAAGGACTGCCGTCTTCTCGGCAAGTTCGACCTATCT
GGCATTCCAGCAGCACCAAGGGGCACCCCCCAGATTGAGGTGACCTTCGAGGTGGACGCC
AACGGCATCCTGAACGTGAAGGCTGAGGACAAGGGCACCGGCAAGTCGGAGAAGATCACG
ATCACGAACGAGAAGGGGCGCCTGAGCCAGGAGGAGATCGACCGGATGGTGCGCGAGGCG
GAGGAGTTTGCGGAGGAGGACAAGAAGGTGAAGGAGCGGATCGACGCCCGCAACCAGCTC
GAGACCTACGTGTACAACATGAAGAACACCGTCGGCGACAAGGACAAGCTGGCGGACAAG
CTGGAGAGCGAGGAGAAGGAGAAGGTGGAGGAGGCCCTCAAGGAGGCCCTCGAGTGGCTG
GACGAGAACCAGACCGCCGAGAAGGAGGAGTACGAGGAGAAGCTCAAGGAGGTCGAGGCC
GTCTGCAACCCCATCATCTCCGCCGTCTACCAGAGGACCGGTGGCGCCCCGGGTGGCGGC
GCCGACGGCGAGGGCGGCGTCGACGACGAGCATGACGAGCTGTAGATGATGATGATGATG
ATCTGATTCGATTGATTCAAAGGAGACAGCCAATTTTTGTAAGAGATGGCCGGTTACTTT
TAGTGGGGTGACTTACTACTACCTTGGGTTGGGGTTTAGGGGTAGCAAGAGGGGAGAGTT
TTATTTGCAGAACACCAGAAAAGAGACTAAATCTCTCCTCTTGTTACTTGTGTTGCTCTC
TTAGTTTGTTACTCTGTCGAGTGTAGAACAGCTCTTCCTTTTGCTACTTCCTTCTGATTT
CCATGTGAACTGTG

CDS

1998 bp

>Os02t0115900-01 ER-localized chaperone HSP70, ER quality control for seed storage proteins during seed maturation, Regulation of XA21 protein stability and processing, Resistance to Xoo,
ATGGATCGGGTTCGCGGATGCGCGTTCCTGCTCGGCGTCCTGCTCGCAGGATCCCTGTTT
GCATTTTCTGTTGCGAAGGAGGAGACCAAGAAGCTCGGTACCGTGATCGGTATTGATCTT
GGTACAACCTACTCGTGTGTCGGTGTGTACAAGAATGGTCATGTCGAGATTATCGCCAAT
GACCAGGGTAACCGTATCACACCCTCATGGGTTGCATTCACCGATAGCGAGAGGCTCATC
GGTGAGGCTGCCAAGAACCAGGCAGCTGTGAACCCAGAGAGGACCATCTTCGATGTCAAA
CGTCTCATTGGAAGAAAGTTTGAAGACAAGGAAGTTCAGAGGGACATGAAACTTGTCCCC
TACAAGATTGTGAACAAGGACGGTAAGCCCTACATTCAGGTCAAGATCAAGGATGGAGAG
AACAAGGTCTTCAGCCCTGAGGAGGTCAGTGCTATGATCCTTGGAAAGATGAAGGAGACT
GCTGAGGCATACCTTGGCAAGAAGATCAACGATGCTGTCGTGACTGTTCCTGCGTACTTC
AATGACGCGCAGAGGCAGGCAACCAAGGATGCCGGTGTCATTGCTGGCCTGAATGTTGCT
AGGATCATCAATGAGCCAACTGCTGCTGCTATTGCGTACGGTTTGGACAAGAAGGGTGGT
GAGAAGAACATCCTTGTCTTTGACCTTGGTGGTGGGACATTCGATGTCAGTATCTTGACC
ATTGACAACGGTGTGTTTGAGGTGTTGGCCACCAATGGTGACACTCATCTTGGAGGTGAG
GACTTTGACCAGAGAATCATGGAGTACTTCATCAAGTTGATCAAGAAGAAGTACAGCAAG
GACATCAGCAAGGACAACCGTGCTCTTGGAAAGCTGAGGAGGGAAGCTGAGCGTGCCAAG
AGGGCCCTCAGCAACCAGCACCAGGTCCGTGTTGAGATTGAGTCCCTCTTTGACGGGACC
GATTTCTCGGAGCCGCTGACCCGTGCCAGATTTGAGGAGTTGAACAATGATCTGTTCCGC
AAGACCATGGGACCTGTCAAGAAGGCTATGGACGATGCTGGCCTTGAGAAGAGCCAGATT
CATGAGATTGTTCTTGTCGGTGGTAGCACCAGGATTCCCAAGGTTCAGCAGCTCCTCAGA
GACTACTTCGAGGGCAAGGAGCCCAACAAGGGTGTCAACCCTGATGAGGCTGTTGCCTAT
GGTGCTGCGGTTCAGGGAAGCATTCTCAGCGGCGAGGGCGGTGACGAAACCAAAGATATC
CTTCTCCTGGATGTGGCACCCCTTACCCTCGGTATCGAGACTGTCGGTGGAGTCATGACC
AAGTTGATCCCCAGGAACACCGTCATCCCCACCAAGAAGTCCCAGGTGTTCACCACCTAC
CAGGATCAGCAGACAACCGTCTCCATCCAGGTCTTTGAGGGTGAGCGCAGCATGACCAAG
GACTGCCGTCTTCTCGGCAAGTTCGACCTATCTGGCATTCCAGCAGCACCAAGGGGCACC
CCCCAGATTGAGGTGACCTTCGAGGTGGACGCCAACGGCATCCTGAACGTGAAGGCTGAG
GACAAGGGCACCGGCAAGTCGGAGAAGATCACGATCACGAACGAGAAGGGGCGCCTGAGC
CAGGAGGAGATCGACCGGATGGTGCGCGAGGCGGAGGAGTTTGCGGAGGAGGACAAGAAG
GTGAAGGAGCGGATCGACGCCCGCAACCAGCTCGAGACCTACGTGTACAACATGAAGAAC
ACCGTCGGCGACAAGGACAAGCTGGCGGACAAGCTGGAGAGCGAGGAGAAGGAGAAGGTG
GAGGAGGCCCTCAAGGAGGCCCTCGAGTGGCTGGACGAGAACCAGACCGCCGAGAAGGAG
GAGTACGAGGAGAAGCTCAAGGAGGTCGAGGCCGTCTGCAACCCCATCATCTCCGCCGTC
TACCAGAGGACCGGTGGCGCCCCGGGTGGCGGCGCCGACGGCGAGGGCGGCGTCGACGAC
GAGCATGACGAGCTGTAG

Protein

666 aa

>Os02t0115900-01 ER-localized chaperone HSP70, ER quality control for seed storage proteins during seed maturation, Regulation of XA21 protein stability and processing, Resistance to Xoo,
MDRVRGCAFLLGVLLAGSLFAFSVAKEETKKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN
DQGNRITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQRDMKLVP
YKIVNKDGKPYIQVKIKDGENKVFSPEEVSAMILGKMKETAEAYLGKKINDAVVTVPAYF
NDAQRQATKDAGVIAGLNVARIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSILT
IDNGVFEVLATNGDTHLGGEDFDQRIMEYFIKLIKKKYSKDISKDNRALGKLRREAERAK
RALSNQHQVRVEIESLFDGTDFSEPLTRARFEELNNDLFRKTMGPVKKAMDDAGLEKSQI
HEIVLVGGSTRIPKVQQLLRDYFEGKEPNKGVNPDEAVAYGAAVQGSILSGEGGDETKDI
LLLDVAPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFTTYQDQQTTVSIQVFEGERSMTK
DCRLLGKFDLSGIPAAPRGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNEKGRLS
QEEIDRMVREAEEFAEEDKKVKERIDARNQLETYVYNMKNTVGDKDKLADKLESEEKEKV
EEALKEALEWLDENQTAEKEEYEEKLKEVEAVCNPIISAVYQRTGGAPGGGADGEGGVDD
EHDEL*

5'UTR

chr02:842526..842672 (- strand) : 147 bp

CDS

chr02:842477..842525 (- strand) : 49 bp

chr02:841489..841756 (- strand) : 268 bp

chr02:841189..841403 (- strand) : 215 bp

chr02:840855..841097 (- strand) : 243 bp

chr02:840078..840557 (- strand) : 480 bp

chr02:839828..839982 (- strand) : 155 bp

chr02:839638..839720 (- strand) : 83 bp

chr02:839048..839552 (- strand) : 505 bp

3'UTR

chr02:838779..839047 (- strand) : 269 bp

FASTA

>Os02t0115900-01 class=Sequence position=chr02:838779..842672 (- strand)
ATAAATCGCC CACGAACCCA TAAAACTCAA ACTCACTTGA AGGTTTTCGG ATCGCAACCC AAACTCGCAC AAGGGAGAAG
AGAAGAGAAG CTTCGAGAGA GAGGTGGAGG AGGAGACGAG CGCGTGGTGG TGGTGGTGTT GGCGGCGATG GATCGGGTTC
GCGGATGCGC GTTCCTGCTC GGCGTCCTGC TCGCAGGTGC GATCTCCCCG TTCCTCGTTT GGATCTGTGC TTGCGCGCGC
TTAGATTTGT CTATTTGATG TTGTGCTGGA GTTCGATCTA AGATGGGCTG TGAATGTTCG TTCCACTGGA TCACGGATCC
GGGAGTAGTT TTTTTTTTTC TCAACGAGAT GGTCCGGTAA ATGGTTTTAG AGTGACACTG ATGGATCGTA TGGATCGTGG
TAGTTAGTTA GGAGATATTT GATATTTGTT TTTTTTGTAC TACTTCACAA ATTGAGGTGC GATTAAACTT AGATGCCACC
AATAGGTGAA GGCGGCGAGT CTGGCGACTC CAAGAAATAT GTGATCTGGG GTTTATTTAT GATTTATCCT AGTAGTGCTC
AGTGATTTTG TTGGAATTCG TTTGTTAGAT ACTGGTTTAA TTGCAGTGAT GCCATGATCT GTCCTGTGCA TTGGTAGCGG
TAGAGTTTTT ACCTTCACAA TTATGCTGAA TATGCTAGTA GTAAAATATT TCTAGGGCAA CACTGAATAG TTTAGAGGCG
CAAAATGTGC TAGAATGGCA TGAATGAAAC GGGCTGCCTA GATTTTCACC TTAGAAACTT ACTTGGTCTC ATAATTCATG
TTACTGTTTT AAAATCACAT GAATTATATG CCTGTGTATA TGTGTGCCAA TACACGATAA ATGGTGAATT GATAGAACAT
GTAGCTTACA TACTGCCACT GCTCCTCTGT TTGCAGGATC CCTGTTTGCA TTTTCTGTTG CGAAGGAGGA GACCAAGAAG
CTCGGTACCG TGATCGGTAT TGATCTTGGT ACAACCTACT CGTGTGTCGG TGTGTACAAG AATGGTCATG TCGAGATTAT
CGCCAATGAC CAGGGTAACC GTATCACACC CTCATGGGTT GCATTCACCG ATAGCGAGAG GCTCATCGGT GAGGCTGCCA
AGAACCAGGC AGCTGTGAAC CCAGAGAGGA CCATCTTCGA TGTCAAACGT CTCATTGGAA GAAAGTAATG GCACTTTACC
CTATGCTCGC TCTTATTTCC TGTTGTTGAT CACTGCTGCC TGATCTGACC TGTATAATTA TTCTTGCAGG TTTGAAGACA
AGGAAGTTCA GAGGGACATG AAACTTGTCC CCTACAAGAT TGTGAACAAG GACGGTAAGC CCTACATTCA GGTCAAGATC
AAGGATGGAG AGAACAAGGT CTTCAGCCCT GAGGAGGTCA GTGCTATGAT CCTTGGAAAG ATGAAGGAGA CTGCTGAGGC
ATACCTTGGC AAGAAGATCA ACGATGCTGT CGTGACTGTT CCTGGTTAGT AATGACAAGA CATTCATGTG CTTAGTTAAC
TCAAGCGGTG ATTCTGTGGA AGCCATTGCT CACTTCTGCT CTTTCATGTT TTCAGCGTAC TTCAATGACG CGCAGAGGCA
GGCAACCAAG GATGCCGGTG TCATTGCTGG CCTGAATGTT GCTAGGATCA TCAATGAGCC AACTGCTGCT GCTATTGCGT
ACGGTTTGGA CAAGAAGGGT GGTGAGAAGA ACATCCTTGT CTTTGACCTT GGTGGTGGGA CATTCGATGT CAGTATCTTG
ACCATTGACA ACGGTGTGTT TGAGGTGTTG GCCACCAATG GTGACACTCA TCTTGGAGGT ATGACTGCTT TTATTTGCCC
TTAGGTACTA AATATCTGCT TCTGTACAAC ATCACAGTTG TAGAGTACTG TAGTTTGATT CAATGATTTT CATGCAACAC
ATCATGGTAA ATTGGTTATC TTATACCTGC ACATTCTCAT TAGACTTTTC AGTAAAGGCA CGCTGTCTTT TAGAAGATTG
GCACTATTCA TTTGCTTTTA AACTAATGAC ATGCCTTTTG TAGTTAGTTG GTCGTCTTGA TTATCTGGAT AGTGCACTGT
GATTCATATT TGACTGAACT GTCTCATCTC TTCAGGTGAG GACTTTGACC AGAGAATCAT GGAGTACTTC ATCAAGTTGA
TCAAGAAGAA GTACAGCAAG GACATCAGCA AGGACAACCG TGCTCTTGGA AAGCTGAGGA GGGAAGCTGA GCGTGCCAAG
AGGGCCCTCA GCAACCAGCA CCAGGTCCGT GTTGAGATTG AGTCCCTCTT TGACGGGACC GATTTCTCGG AGCCGCTGAC
CCGTGCCAGA TTTGAGGAGT TGAACAATGA TCTGTTCCGC AAGACCATGG GACCTGTCAA GAAGGCTATG GACGATGCTG
GCCTTGAGAA GAGCCAGATT CATGAGATTG TTCTTGTCGG TGGTAGCACC AGGATTCCCA AGGTTCAGCA GCTCCTCAGA
GACTACTTCG AGGGCAAGGA GCCCAACAAG GGTGTCAACC CTGATGAGGC TGTTGCCTAT GGTGCTGCGG TTCAGGGAAG
CATTCTCAGC GGCGAGGGCG GTGACGAAAC CAAAGGTTCG ACCTTGATCA CATACATAGT CCTTTGGGTT GGTAACAACT
GCGATCATCT GTCTTGCATA TACTTATCGT GCTTTGATTT TGGTACGCAG ATATCCTTCT CCTGGATGTG GCACCCCTTA
CCCTCGGTAT CGAGACTGTC GGTGGAGTCA TGACCAAGTT GATCCCCAGG AACACCGTCA TCCCCACCAA GAAGTCCCAG
GTGTTCACCA CCTACCAGGA TCAGCAGACA ACCGTCTCCA TCCAGGTAAC AGACATAAGC AAACTTTCTT CTTTGAGTCC
TGACATTACA TCCTGGTCAG AAAATTTCAG CTCAGACCAC CTAACGCCTC TGAATCTCGC CTTGTGGTGT AGGTCTTTGA
GGGTGAGCGC AGCATGACCA AGGACTGCCG TCTTCTCGGC AAGTTCGACC TATCTGGCAT TCCAGCAGCA CCAAGGTTTG
CTCATGTCCA GAAAAAAATG TTAGCTTACT CAAATGGATA AATGAATCCA GCGCCTGATA TCTGTTGGTT AAACTTGCAG
GGGCACCCCC CAGATTGAGG TGACCTTCGA GGTGGACGCC AACGGCATCC TGAACGTGAA GGCTGAGGAC AAGGGCACCG
GCAAGTCGGA GAAGATCACG ATCACGAACG AGAAGGGGCG CCTGAGCCAG GAGGAGATCG ACCGGATGGT GCGCGAGGCG
GAGGAGTTTG CGGAGGAGGA CAAGAAGGTG AAGGAGCGGA TCGACGCCCG CAACCAGCTC GAGACCTACG TGTACAACAT
GAAGAACACC GTCGGCGACA AGGACAAGCT GGCGGACAAG CTGGAGAGCG AGGAGAAGGA GAAGGTGGAG GAGGCCCTCA
AGGAGGCCCT CGAGTGGCTG GACGAGAACC AGACCGCCGA GAAGGAGGAG TACGAGGAGA AGCTCAAGGA GGTCGAGGCC
GTCTGCAACC CCATCATCTC CGCCGTCTAC CAGAGGACCG GTGGCGCCCC GGGTGGCGGC GCCGACGGCG AGGGCGGCGT
CGACGACGAG CATGACGAGC TGTAGATGAT GATGATGATG ATCTGATTCG ATTGATTCAA AGGAGACAGC CAATTTTTGT
AAGAGATGGC CGGTTACTTT TAGTGGGGTG ACTTACTACT ACCTTGGGTT GGGGTTTAGG GGTAGCAAGA GGGGAGAGTT
TTATTTGCAG AACACCAGAA AAGAGACTAA ATCTCTCCTC TTGTTACTTG TGTTGCTCTC TTAGTTTGTT ACTCTGTCGA
GTGTAGAACA GCTCTTCCTT TTGCTACTTC CTTCTGATTT CCATGTGAAC TGTG

Locus: Os02g0115900

Loading...

Locus: Os02g0115900

Loading...