Os02t0115900-02

Locus

Os02g0115900

Description

Endosperm lumenal binding protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsBiP1, BiP1, BiP, Bip3, OsBiP3, BIP1/OsBIP3, OsMed37_2, Med37_2

Oryzabase Gene Name Synonym(s)

ER chaperone BiP1, Binding protein 1, binding protein, endosperm lumenal binding protein, endoplasmic reticulum (ER) chaperone BiP3, Polypeptide chain-binding protein, Mediator 37_2

Transcript Evidence

AK065743 (DDBJ, Best hit)

Protein Evidence

O24182 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: ATP binding (GO:0005524)

Functional domain (InterPro)

Heat shock protein Hsp70 (IPR001023)

Heat shock protein 70 (IPR013126)

Heat shock protein 70, conserved site (IPR018181)

Full-length cDNA

J013040G16 (Online Clone Ordering)

Expression Databases

TENOR (Os02t0115900-02)

RiceXPro (AK065743)

Others

Oryzabase (10082)

KEGG (Os02t0115900-02)

Transcript

2416 bp

>Os02t0115900-02 Endosperm lumenal binding protein.
ACTTGAAGGTTTTCGGATCGCAACCCAAACTCGCACAAGGGAGAAGAGAAGAGAAGCTTC
GAGAGAGAGGTGGAGGAGGAGACGAGCGCGTGGTGGTGGTGGTGTTGGCGGCGATGGATC
GGGTTCGCGGATGCGCGTTCCTGCTCGGCGTCCTGCTCGCAGGATCCCTGTTTGCATTTT
CTGTTGCGAAGGAGGAGACCAAGAAGCTCGGTACCGTGATCGGTATTGATCTTGGTACAA
CCTACTCGTGTGTCGGTGTGTACAAGAATGGTCATGTCGAGATTATCGCCAATGACCAGG
GTAACCGTATCACACCCTCATGGGTTGCATTCACCGATAGCGAGAGGCTCATCGGTGAGG
CTGCCAAGAACCAGGCAGCTGTGAACCCAGAGAGGACCATCTTCGATGTCAAACGTCTCA
TTGGAAGAAAGTTTGAAGACAAGGAAGTTCAGAGGGACATGAAACTTGTCCCCTACAAGA
TTGTGAACAAGGACGGTAAGCCCTACATTCAGGTCAAGATCAAGGATGGAGAGAACAAGG
TCTTCAGCCCTGAGGAGGTCAGTGCTATGATCCTTGGAAAGATGAAGGAGACTGCTGAGG
CATACCTTGGCAAGAAGATCAACGATGCTGTCGTGACTGTTCCTGCGTACTTCAATGACG
CGCAGAGGCAGGCAACCAAGGATGCCGGTGTCATTGCTGGCCTGAATGTTGCTAGGATCA
TCAATGAGCCAACTGCTGCTGCTATTGCGTACGGTTTGGACAAGAAGGGTGGTGAGAAGA
ACATCCTTGTCTTTGACCTTGGTGGTGGGACATTCGATGTCAGTATCTTGACCATTGACA
ACGGTGTGTTTGAGGTGTTGGCCACCAATGGTGACACTCATCTTGGAGGTGAGGACTTTG
ACCAGAGAATCATGGAGTACTTCATCAAGTTGATCAAGAAGAAGTACAGCAAGGACATCA
GCAAGGACAACCGTGCTCTTGGAAAGCTGAGGAGGGAAGCTGAGCGTGCCAAGAGGGCCC
TCAGCAACCAGCACCAGGTCCGTGTTGAGATTGAGTCCCTCTTTGACGGGACCGATTTCT
CGGAGCCGCTGACCCGTGCCAGATTTGAGGAGTTGAACAATGATCTGTTCCGCAAGACCA
TGGGACCTGTCAAGAAGGCTATGGACGATGCTGGCCTTGAGAAGAGCCAGATTCATGAGA
TTGTTCTTGTCGGTGGTAGCACCAGGATTCCCAAGGTTCAGCAGCTCCTCAGAGACTACT
TCGAGGGCAAGGAGCCCAACAAGGGTGTCAACCCTGATGAGGCTGTTGCCTATGGTGCTG
CGGTTCAGGGAAGCATTCTCAGCGGCGAGGGCGGTGACGAAACCAAAGATATCCTTCTCC
TGGATGTGGCACCCCTTACCCTCGGTATCGAGACTGTCGGTGGAGTCATGACCAAGTTGA
TCCCCAGGAACACCGTCATCCCCACCAAGAAGTCCCAGGTGTTCACCACCTACCAGGATC
AGCAGACAACCGTCTCCATCCAGGTCTTTGAGGGTGAGCGCAGCATGACCAAGGACTGCC
GTCTTCTCGGCAAGTTCGACCTATCTGGCATTCCAGCAGCACCAAGGGGCACCCCCCAGA
TTGAGGTGACCTTCGAGGTGGACGCCAACGGCATCCTGAACGTGAAGGCTGAGGACAAGG
GCACCGGCAAGTCGGAGAAGATCACGATCACGAACGAGAAGGGGCGCCTGAGCCAGGAGG
AGATCGACCGGATGGTGCGCGAGGCGGAGGAGTTTGCGGAGGAGGACAAGAAGGTGAAGG
AGCGGATCGACGCCCGCAACCAGCTCGAGACCTACGTGTACAACATGAAGAACACCGTCG
GCGACAAGGACAAGCTGGCGGACAAGCTGGAGAGCGAGGAGAAGGAGAAGGTGGAGGAGG
CCCTCAAGGAGGCCCTCGAGTGGCTGGACGAGAACCAGACCGCCGAGAAGGAGGAGTACG
AGGAGAAGCTCAAGGAGGTCGAGGCCGTCTGCAACCCCATCATCTCCGCCGTCTACCAGA
GGACCGGTGGCGCCCCGGGTGGCGGCGCCGACGGCGAGGGCGGCGTCGACGACGAGCATG
ACGAGCTGTAGATGATGATGATGATGATCTGATTCGATTGATTCAAAGGAGACAGCCAAT
TTTTGTAAGAGATGGCCGGTTACTTTTAGTGGGGTGACTTACTACTACCTTGGGTTGGGG
TTTAGGGGTAGCAAGAGGGGAGAGTTTTATTTGCAGAACACCAGAAAAGAGACTAAATCT
CTCCTCTTGTTACTTGTGTTGCTCTCTTAGTTTGTTACTCTGTCGAGTGTAGAACAGCTC
TTCCTTTTGCTACTTCCTTCTGATTTCCATGTGAACTGTGAAGAAGAAGAAGAAACATAA
GTAAATTTTAATTACT

CDS

1998 bp

>Os02t0115900-02 Endosperm lumenal binding protein.
ATGGATCGGGTTCGCGGATGCGCGTTCCTGCTCGGCGTCCTGCTCGCAGGATCCCTGTTT
GCATTTTCTGTTGCGAAGGAGGAGACCAAGAAGCTCGGTACCGTGATCGGTATTGATCTT
GGTACAACCTACTCGTGTGTCGGTGTGTACAAGAATGGTCATGTCGAGATTATCGCCAAT
GACCAGGGTAACCGTATCACACCCTCATGGGTTGCATTCACCGATAGCGAGAGGCTCATC
GGTGAGGCTGCCAAGAACCAGGCAGCTGTGAACCCAGAGAGGACCATCTTCGATGTCAAA
CGTCTCATTGGAAGAAAGTTTGAAGACAAGGAAGTTCAGAGGGACATGAAACTTGTCCCC
TACAAGATTGTGAACAAGGACGGTAAGCCCTACATTCAGGTCAAGATCAAGGATGGAGAG
AACAAGGTCTTCAGCCCTGAGGAGGTCAGTGCTATGATCCTTGGAAAGATGAAGGAGACT
GCTGAGGCATACCTTGGCAAGAAGATCAACGATGCTGTCGTGACTGTTCCTGCGTACTTC
AATGACGCGCAGAGGCAGGCAACCAAGGATGCCGGTGTCATTGCTGGCCTGAATGTTGCT
AGGATCATCAATGAGCCAACTGCTGCTGCTATTGCGTACGGTTTGGACAAGAAGGGTGGT
GAGAAGAACATCCTTGTCTTTGACCTTGGTGGTGGGACATTCGATGTCAGTATCTTGACC
ATTGACAACGGTGTGTTTGAGGTGTTGGCCACCAATGGTGACACTCATCTTGGAGGTGAG
GACTTTGACCAGAGAATCATGGAGTACTTCATCAAGTTGATCAAGAAGAAGTACAGCAAG
GACATCAGCAAGGACAACCGTGCTCTTGGAAAGCTGAGGAGGGAAGCTGAGCGTGCCAAG
AGGGCCCTCAGCAACCAGCACCAGGTCCGTGTTGAGATTGAGTCCCTCTTTGACGGGACC
GATTTCTCGGAGCCGCTGACCCGTGCCAGATTTGAGGAGTTGAACAATGATCTGTTCCGC
AAGACCATGGGACCTGTCAAGAAGGCTATGGACGATGCTGGCCTTGAGAAGAGCCAGATT
CATGAGATTGTTCTTGTCGGTGGTAGCACCAGGATTCCCAAGGTTCAGCAGCTCCTCAGA
GACTACTTCGAGGGCAAGGAGCCCAACAAGGGTGTCAACCCTGATGAGGCTGTTGCCTAT
GGTGCTGCGGTTCAGGGAAGCATTCTCAGCGGCGAGGGCGGTGACGAAACCAAAGATATC
CTTCTCCTGGATGTGGCACCCCTTACCCTCGGTATCGAGACTGTCGGTGGAGTCATGACC
AAGTTGATCCCCAGGAACACCGTCATCCCCACCAAGAAGTCCCAGGTGTTCACCACCTAC
CAGGATCAGCAGACAACCGTCTCCATCCAGGTCTTTGAGGGTGAGCGCAGCATGACCAAG
GACTGCCGTCTTCTCGGCAAGTTCGACCTATCTGGCATTCCAGCAGCACCAAGGGGCACC
CCCCAGATTGAGGTGACCTTCGAGGTGGACGCCAACGGCATCCTGAACGTGAAGGCTGAG
GACAAGGGCACCGGCAAGTCGGAGAAGATCACGATCACGAACGAGAAGGGGCGCCTGAGC
CAGGAGGAGATCGACCGGATGGTGCGCGAGGCGGAGGAGTTTGCGGAGGAGGACAAGAAG
GTGAAGGAGCGGATCGACGCCCGCAACCAGCTCGAGACCTACGTGTACAACATGAAGAAC
ACCGTCGGCGACAAGGACAAGCTGGCGGACAAGCTGGAGAGCGAGGAGAAGGAGAAGGTG
GAGGAGGCCCTCAAGGAGGCCCTCGAGTGGCTGGACGAGAACCAGACCGCCGAGAAGGAG
GAGTACGAGGAGAAGCTCAAGGAGGTCGAGGCCGTCTGCAACCCCATCATCTCCGCCGTC
TACCAGAGGACCGGTGGCGCCCCGGGTGGCGGCGCCGACGGCGAGGGCGGCGTCGACGAC
GAGCATGACGAGCTGTAG

Protein

666 aa

>Os02t0115900-02 Endosperm lumenal binding protein.
MDRVRGCAFLLGVLLAGSLFAFSVAKEETKKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN
DQGNRITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQRDMKLVP
YKIVNKDGKPYIQVKIKDGENKVFSPEEVSAMILGKMKETAEAYLGKKINDAVVTVPAYF
NDAQRQATKDAGVIAGLNVARIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSILT
IDNGVFEVLATNGDTHLGGEDFDQRIMEYFIKLIKKKYSKDISKDNRALGKLRREAERAK
RALSNQHQVRVEIESLFDGTDFSEPLTRARFEELNNDLFRKTMGPVKKAMDDAGLEKSQI
HEIVLVGGSTRIPKVQQLLRDYFEGKEPNKGVNPDEAVAYGAAVQGSILSGEGGDETKDI
LLLDVAPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFTTYQDQQTTVSIQVFEGERSMTK
DCRLLGKFDLSGIPAAPRGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNEKGRLS
QEEIDRMVREAEEFAEEDKKVKERIDARNQLETYVYNMKNTVGDKDKLADKLESEEKEKV
EEALKEALEWLDENQTAEKEEYEEKLKEVEAVCNPIISAVYQRTGGAPGGGADGEGGVDD
EHDEL*

5'UTR

chr02:842526..842638 (- strand) : 113 bp

CDS

chr02:842477..842525 (- strand) : 49 bp

chr02:841489..841756 (- strand) : 268 bp

chr02:841189..841403 (- strand) : 215 bp

chr02:840855..841097 (- strand) : 243 bp

chr02:840078..840557 (- strand) : 480 bp

chr02:839828..839982 (- strand) : 155 bp

chr02:839638..839720 (- strand) : 83 bp

chr02:839048..839552 (- strand) : 505 bp

3'UTR

chr02:838743..839047 (- strand) : 305 bp

FASTA

>Os02t0115900-02 class=Sequence position=chr02:838743..842638 (- strand)
ACTTGAAGGT TTTCGGATCG CAACCCAAAC TCGCACAAGG GAGAAGAGAA GAGAAGCTTC GAGAGAGAGG TGGAGGAGGA
GACGAGCGCG TGGTGGTGGT GGTGTTGGCG GCGATGGATC GGGTTCGCGG ATGCGCGTTC CTGCTCGGCG TCCTGCTCGC
AGGTGCGATC TCCCCGTTCC TCGTTTGGAT CTGTGCTTGC GCGCGCTTAG ATTTGTCTAT TTGATGTTGT GCTGGAGTTC
GATCTAAGAT GGGCTGTGAA TGTTCGTTCC ACTGGATCAC GGATCCGGGA GTAGTTTTTT TTTTTCTCAA CGAGATGGTC
CGGTAAATGG TTTTAGAGTG ACACTGATGG ATCGTATGGA TCGTGGTAGT TAGTTAGGAG ATATTTGATA TTTGTTTTTT
TTGTACTACT TCACAAATTG AGGTGCGATT AAACTTAGAT GCCACCAATA GGTGAAGGCG GCGAGTCTGG CGACTCCAAG
AAATATGTGA TCTGGGGTTT ATTTATGATT TATCCTAGTA GTGCTCAGTG ATTTTGTTGG AATTCGTTTG TTAGATACTG
GTTTAATTGC AGTGATGCCA TGATCTGTCC TGTGCATTGG TAGCGGTAGA GTTTTTACCT TCACAATTAT GCTGAATATG
CTAGTAGTAA AATATTTCTA GGGCAACACT GAATAGTTTA GAGGCGCAAA ATGTGCTAGA ATGGCATGAA TGAAACGGGC
TGCCTAGATT TTCACCTTAG AAACTTACTT GGTCTCATAA TTCATGTTAC TGTTTTAAAA TCACATGAAT TATATGCCTG
TGTATATGTG TGCCAATACA CGATAAATGG TGAATTGATA GAACATGTAG CTTACATACT GCCACTGCTC CTCTGTTTGC
AGGATCCCTG TTTGCATTTT CTGTTGCGAA GGAGGAGACC AAGAAGCTCG GTACCGTGAT CGGTATTGAT CTTGGTACAA
CCTACTCGTG TGTCGGTGTG TACAAGAATG GTCATGTCGA GATTATCGCC AATGACCAGG GTAACCGTAT CACACCCTCA
TGGGTTGCAT TCACCGATAG CGAGAGGCTC ATCGGTGAGG CTGCCAAGAA CCAGGCAGCT GTGAACCCAG AGAGGACCAT
CTTCGATGTC AAACGTCTCA TTGGAAGAAA GTAATGGCAC TTTACCCTAT GCTCGCTCTT ATTTCCTGTT GTTGATCACT
GCTGCCTGAT CTGACCTGTA TAATTATTCT TGCAGGTTTG AAGACAAGGA AGTTCAGAGG GACATGAAAC TTGTCCCCTA
CAAGATTGTG AACAAGGACG GTAAGCCCTA CATTCAGGTC AAGATCAAGG ATGGAGAGAA CAAGGTCTTC AGCCCTGAGG
AGGTCAGTGC TATGATCCTT GGAAAGATGA AGGAGACTGC TGAGGCATAC CTTGGCAAGA AGATCAACGA TGCTGTCGTG
ACTGTTCCTG GTTAGTAATG ACAAGACATT CATGTGCTTA GTTAACTCAA GCGGTGATTC TGTGGAAGCC ATTGCTCACT
TCTGCTCTTT CATGTTTTCA GCGTACTTCA ATGACGCGCA GAGGCAGGCA ACCAAGGATG CCGGTGTCAT TGCTGGCCTG
AATGTTGCTA GGATCATCAA TGAGCCAACT GCTGCTGCTA TTGCGTACGG TTTGGACAAG AAGGGTGGTG AGAAGAACAT
CCTTGTCTTT GACCTTGGTG GTGGGACATT CGATGTCAGT ATCTTGACCA TTGACAACGG TGTGTTTGAG GTGTTGGCCA
CCAATGGTGA CACTCATCTT GGAGGTATGA CTGCTTTTAT TTGCCCTTAG GTACTAAATA TCTGCTTCTG TACAACATCA
CAGTTGTAGA GTACTGTAGT TTGATTCAAT GATTTTCATG CAACACATCA TGGTAAATTG GTTATCTTAT ACCTGCACAT
TCTCATTAGA CTTTTCAGTA AAGGCACGCT GTCTTTTAGA AGATTGGCAC TATTCATTTG CTTTTAAACT AATGACATGC
CTTTTGTAGT TAGTTGGTCG TCTTGATTAT CTGGATAGTG CACTGTGATT CATATTTGAC TGAACTGTCT CATCTCTTCA
GGTGAGGACT TTGACCAGAG AATCATGGAG TACTTCATCA AGTTGATCAA GAAGAAGTAC AGCAAGGACA TCAGCAAGGA
CAACCGTGCT CTTGGAAAGC TGAGGAGGGA AGCTGAGCGT GCCAAGAGGG CCCTCAGCAA CCAGCACCAG GTCCGTGTTG
AGATTGAGTC CCTCTTTGAC GGGACCGATT TCTCGGAGCC GCTGACCCGT GCCAGATTTG AGGAGTTGAA CAATGATCTG
TTCCGCAAGA CCATGGGACC TGTCAAGAAG GCTATGGACG ATGCTGGCCT TGAGAAGAGC CAGATTCATG AGATTGTTCT
TGTCGGTGGT AGCACCAGGA TTCCCAAGGT TCAGCAGCTC CTCAGAGACT ACTTCGAGGG CAAGGAGCCC AACAAGGGTG
TCAACCCTGA TGAGGCTGTT GCCTATGGTG CTGCGGTTCA GGGAAGCATT CTCAGCGGCG AGGGCGGTGA CGAAACCAAA
GGTTCGACCT TGATCACATA CATAGTCCTT TGGGTTGGTA ACAACTGCGA TCATCTGTCT TGCATATACT TATCGTGCTT
TGATTTTGGT ACGCAGATAT CCTTCTCCTG GATGTGGCAC CCCTTACCCT CGGTATCGAG ACTGTCGGTG GAGTCATGAC
CAAGTTGATC CCCAGGAACA CCGTCATCCC CACCAAGAAG TCCCAGGTGT TCACCACCTA CCAGGATCAG CAGACAACCG
TCTCCATCCA GGTAACAGAC ATAAGCAAAC TTTCTTCTTT GAGTCCTGAC ATTACATCCT GGTCAGAAAA TTTCAGCTCA
GACCACCTAA CGCCTCTGAA TCTCGCCTTG TGGTGTAGGT CTTTGAGGGT GAGCGCAGCA TGACCAAGGA CTGCCGTCTT
CTCGGCAAGT TCGACCTATC TGGCATTCCA GCAGCACCAA GGTTTGCTCA TGTCCAGAAA AAAATGTTAG CTTACTCAAA
TGGATAAATG AATCCAGCGC CTGATATCTG TTGGTTAAAC TTGCAGGGGC ACCCCCCAGA TTGAGGTGAC CTTCGAGGTG
GACGCCAACG GCATCCTGAA CGTGAAGGCT GAGGACAAGG GCACCGGCAA GTCGGAGAAG ATCACGATCA CGAACGAGAA
GGGGCGCCTG AGCCAGGAGG AGATCGACCG GATGGTGCGC GAGGCGGAGG AGTTTGCGGA GGAGGACAAG AAGGTGAAGG
AGCGGATCGA CGCCCGCAAC CAGCTCGAGA CCTACGTGTA CAACATGAAG AACACCGTCG GCGACAAGGA CAAGCTGGCG
GACAAGCTGG AGAGCGAGGA GAAGGAGAAG GTGGAGGAGG CCCTCAAGGA GGCCCTCGAG TGGCTGGACG AGAACCAGAC
CGCCGAGAAG GAGGAGTACG AGGAGAAGCT CAAGGAGGTC GAGGCCGTCT GCAACCCCAT CATCTCCGCC GTCTACCAGA
GGACCGGTGG CGCCCCGGGT GGCGGCGCCG ACGGCGAGGG CGGCGTCGAC GACGAGCATG ACGAGCTGTA GATGATGATG
ATGATGATCT GATTCGATTG ATTCAAAGGA GACAGCCAAT TTTTGTAAGA GATGGCCGGT TACTTTTAGT GGGGTGACTT
ACTACTACCT TGGGTTGGGG TTTAGGGGTA GCAAGAGGGG AGAGTTTTAT TTGCAGAACA CCAGAAAAGA GACTAAATCT
CTCCTCTTGT TACTTGTGTT GCTCTCTTAG TTTGTTACTC TGTCGAGTGT AGAACAGCTC TTCCTTTTGC TACTTCCTTC
TGATTTCCAT GTGAACTGTG AAGAAGAAGA AGAAACATAA GTAAATTTTA ATTACT

Locus: Os02g0115900

Loading...

Locus: Os02g0115900

Loading...